KEGG   Shigella flexneri 8401 (serotype 5b): SFV_4142Help
Entry
SFV_4142          CDS       T00377                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv00010  Glycolysis / Gluconeogenesis
sfv00620  Pyruvate metabolism
sfv00640  Propanoate metabolism
sfv00680  Methane metabolism
sfv01100  Metabolic pathways
sfv01110  Biosynthesis of secondary metabolites
sfv01120  Microbial metabolism in diverse environments
sfv01130  Biosynthesis of antibiotics
sfv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SFV_4142 (acs)
   00620 Pyruvate metabolism
    SFV_4142 (acs)
   00640 Propanoate metabolism
    SFV_4142 (acs)
  Energy metabolism
   00680 Methane metabolism
    SFV_4142 (acs)
Enzymes [BR:sfv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SFV_4142 (acs)
Lipid biosynthesis proteins [BR:sfv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SFV_4142 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABF06127
UniProt: Q0SXT8
Position
4274257..4276215
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINVPDTFWGEQGKILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAMHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGNIDWQEGRDLWWHDL
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGNPLEGATEGSLVITDSWPGQVRTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgtacctgataccttctggggc
gaacagggaaaaattctcgactggatcaaaccgtaccagaaggtgaaaaatacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgcaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgagctgggcattaaaaaaggtgatgtggtggcgatttatatgccg
atggtgccggaagccgcggttgcgatgctggcctgcgcccgcattggcgcgatgcattcg
gtgattttcggcggcttctcgccggaagccgttgccgggcgcattattgattccaactca
cgactggtgatcacttccgacgaaggcgtgcgcgccgggcgtagtattccgctgaagaaa
aacgttgatgacgcactaaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcggaaacatcgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagccagcgatcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctatacctccggttctaccggaaaaccaaaaggcgtactgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggtgatatc
tactggtgcaccgccgatgtgggctgggttaccggacacagttatttgctgtacggcccg
ctggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcgcaggtggtggacaagcatcaggtcaatattctctataccgcacccacggcg
atccgcgcgctgatggcggaaggcgataaagcgattgaaggcaccgaccgttcgtcgcta
cgcattctcggttccgtgggcgagccaattaacccggaagcgtgggagtggtactggaaa
aaaatcggcaacgagaaatgtccggtggtcgatacctggtggcagaccgaaaccggcggt
ttcatgatcaccccgctgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtgcaaccggcgctggtcgataacgaaggtaacccgctggaaggggctacc
gaaggtagcctggtgatcaccgactcctggcctggtcaggtgcgtacgctgtttggcgat
cacgaacgttttgagcagacctatttttccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaagatggctattactggatcaccgggcgtgtggacgacgtgctg
aacgtctccggtcaccgtctggggacggcagagatagagtcggcgctggtggcgcatccg
aagattgccgaagccgccgtagtaggtattccgcacaatattaaaggtcaggcgatctac
gcctatgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtggtcgagaag
ctgcttgaagagaagcaggctatcgcgatgccatcgtaa

DBGET integrated database retrieval system