KEGG   Shigella flexneri 8401 (serotype 5b): SFV_4234Help
Entry
SFV_4234          CDS       T00377                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sfv  Shigella flexneri 8401 (serotype 5b)
Pathway
sfv00230  Purine metabolism
sfv00240  Pyrimidine metabolism
sfv01100  Metabolic pathways
sfv03030  DNA replication
sfv03430  Mismatch repair
sfv03440  Homologous recombination
Module
sfv_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sfv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SFV_4234 (holC)
   00240 Pyrimidine metabolism
    SFV_4234 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SFV_4234 (holC)
   03430 Mismatch repair
    SFV_4234 (holC)
   03440 Homologous recombination
    SFV_4234 (holC)
Enzymes [BR:sfv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SFV_4234 (holC)
DNA replication proteins [BR:sfv03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SFV_4234 (holC)
DNA repair and recombination proteins [BR:sfv03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SFV_4234 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABF06216
UniProt: Q0SXJ9
Position
4371873..4372316
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE
DSLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcaacgttctaccttctggacaatgacaccaccgtcgatggcttaagcgcc
gttgagcaactggtgtgtgaaattgccgcagaacgttggcgcagcggtaagcgcgtactc
atcgcctgtgaagatgaaaagcaggcttaccggctggatgaagccctgtgggcgcgtccg
gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcggtgcgccggtg
gagatcgcctggccgcaaaaacgcagcagcagcccgcgcgatatattgattagtctgcga
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa
gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system