KEGG   Shigella flexneri 2457T (serotype 2a): S0137Help
Entry
S0137             CDS       T00128                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(148522..149001)
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESRILAVSSFYRTPPLGPQDQPDYLNAAVA
LETSPAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELAFPDGETLREVLHTRAFDKLSKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatatccctgaaagccgcattcttgccgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacctcaacgccgccgtggcg
cttgaaacttcgcccgccccggaagagttactcaaccatacacagcgcatagaactgcaa
cagggtcgtgttcgtaaagctgaacgctggggaccacgcacgctggatctcgatatcatg
ctgtttggtaatgaagtgataaataccgaacgcctgaccgttccgcactacgatatgaag
aatcgtggatttatgctgtggccgctgtttgagattgcaccggagctggcgtttcctgat
ggggagacgttgcgtgaagtcttacatacaagagcatttgacaaattaagcaaatggtaa

DBGET integrated database retrieval system