KEGG   Shigella flexneri 2457T (serotype 2a): S0313Help
Entry
S0313             CDS       T00128                                 

Gene name
proB
Definition
(GenBank) gamma-glutamate kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00330  Arginine and proline metabolism
sfx00332  Carbapenem biosynthesis
sfx01100  Metabolic pathways
sfx01130  Biosynthesis of antibiotics
sfx01230  Biosynthesis of amino acids
Module
sfx_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    S0313 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    S0313 (proB)
Enzymes [BR:sfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     S0313 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AAP15838
UniProt: Q7UDL2
Position
311270..312373
Genome map
AA seq 367 aa AA seqDB search
MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPR
RNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPG
VIGDVMEGISVGTLFHAQATPLENRKRWIFGAPPAGEITVDEGATAAILERGSSLLPKGI
KSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVH
RDDMITR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacagccagacgctggtggtaaaactcggcaccagtgtgctaacaggcggatcg
cgccgtctgaaccgtgcccatatcgttgaacttgttcgccagtgcgcgcagttacatgcc
gccgggcatcggattgttattgtgacgtcgggcgcgatcgccgccggacgtgagcacctg
ggttacccggaactgccagcgactatcgcctcgaaacaactgctggcggcggtagggcag
agtcgactgattcaactgtgggaacagctgttttcgatttatggcattcacgtcgggcaa
atgctgctgacccgtgctgatatggaagaccgtgaacgcttcctgaacgcccgcgacacc
ctgcgtgcgttgctcgataacaatatcgttccggtaatcaatgagaacgatgctgtcgct
acggcagagattaaggtcggcgataacgataacctttctgcgctggcggcgattctggcg
ggtgccgataaactgttgctgctgaccgatcaaaaaggtttgtataccgctgatccgcgc
agaaatccgcaggcagaactgattaaagatgtttacggcattgatgacgcactgcgcgcg
attgccggtgacagcgtttcaggcctcggaactggcggcatgagtactaaattgcaggcc
gctgacgtggcttgccgtgcgggtatcgacaccattattgccgcgggcagcaagccgggc
gttattggtgatgtgatggaaggcatttccgtcggtacgctgttccatgcccaggcgact
ccgcttgaaaaccgtaaacgctggattttcggtgcgccgccggcgggtgaaatcacggta
gatgaaggggcaactgccgccattctggaacgcggcagctccctgttgccgaaaggcatt
aaaagcgtgactggcaatttctcgcgtggtgaagtcatccgcatttgcaacctcgaaggt
cgcgatatcgcccacggtgtcagtcgttacaacagcgatgcattacgccgtattgccgga
caccactcgcaagaaattgatgcaatactgggatatgaatacggcccggttgccgttcac
cgtgatgacatgattacccgttaa

DBGET integrated database retrieval system