KEGG   Shigella flexneri 2457T (serotype 2a): S0428Help
Entry
S0428             CDS       T00128                                 

Gene name
ybaC
Definition
lipase (EC:3.1.1.-)
Orthology
K01066  
esterase / lipase [EC:3.1.1.-]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00363 Bisphenol degradation
    S0428 (ybaC)
Enzymes [BR:sfx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     S0428 (ybaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(435377..436195)
Genome map
AA seq 272 aa AA seqDB search
MKPENKLPVLDLISAEMKTVVNTLQPDLPSWPATGTIAEQRQYYTLERRFWNAGAPEMAT
RAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIG
INYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRD
KQIDCGKIAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYY
CLFNNDLTREVPPCFIAGAEFDPLLDDSRLLY
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggaaaacaaactacctgttctggaccttatttctgctgaaatgaagaccgtt
gtgaatactcttcagccggatttaccgtcctggcccgcaacgggaacgattgctgagcaa
cgacagtattacacgcttgagcgccgattctggaatgcgggcgctccagaaatggcaacc
agagcttacatggttccaacaaaatatgggcaggtggaaacacgtctcttttgtccgcag
ccagatagcccggcgacgctattttatttgcatggaggcggttttattctcggcaatctc
gatacccacgatcgcatcatgcgcctgctggcaagctacagccaatgtacggtgattggt
attaattacaccctttcacctgaagcgcgttttccacaagcgatagaggaaattgtggct
gcttgttgttatttccaccagcaggcggaggattatcaaatcaatatgtcccgcattggc
tttgccggtgattccgcaggtgccatgctggcgctcgccagtgcgttgtggttgcgtgat
aaacagatcgattgcggtaaaattgcgggtgttttgctgtggtatgggctttacggatta
cgggattccgtgactcgtcgtctgttgggcggtgtctgggatggcttaacgcaacaggat
ttgcagatgtatgaagaggcgtatttaagcaacgacgcggaccgcgagtcaccgtattac
tgtctgtttaataatgatctcactcgcgaagttccgccctgttttattgccggggcggag
ttcgatccgctgctggatgacagccgtctgctttactag

DBGET integrated database retrieval system