KEGG   Shigella flexneri 2457T (serotype 2a): S0428Help
Entry
S0428             CDS       T00128                                 

Gene name
ybaC
Definition
lipase (EC:3.1.1.-)
Orthology
K01066  
esterase / lipase [EC:3.1.1.-]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Bisphenol degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(435377..436195)
Genome map
AA seq 272 aa AA seqDB search
MKPENKLPVLDLISAEMKTVVNTLQPDLPSWPATGTIAEQRQYYTLERRFWNAGAPEMAT
RAYMVPTKYGQVETRLFCPQPDSPATLFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIG
INYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRD
KQIDCGKIAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYY
CLFNNDLTREVPPCFIAGAEFDPLLDDSRLLY
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggaaaacaaactacctgttctggaccttatttctgctgaaatgaagaccgtt
gtgaatactcttcagccggatttaccgtcctggcccgcaacgggaacgattgctgagcaa
cgacagtattacacgcttgagcgccgattctggaatgcgggcgctccagaaatggcaacc
agagcttacatggttccaacaaaatatgggcaggtggaaacacgtctcttttgtccgcag
ccagatagcccggcgacgctattttatttgcatggaggcggttttattctcggcaatctc
gatacccacgatcgcatcatgcgcctgctggcaagctacagccaatgtacggtgattggt
attaattacaccctttcacctgaagcgcgttttccacaagcgatagaggaaattgtggct
gcttgttgttatttccaccagcaggcggaggattatcaaatcaatatgtcccgcattggc
tttgccggtgattccgcaggtgccatgctggcgctcgccagtgcgttgtggttgcgtgat
aaacagatcgattgcggtaaaattgcgggtgttttgctgtggtatgggctttacggatta
cgggattccgtgactcgtcgtctgttgggcggtgtctgggatggcttaacgcaacaggat
ttgcagatgtatgaagaggcgtatttaagcaacgacgcggaccgcgagtcaccgtattac
tgtctgtttaataatgatctcactcgcgaagttccgccctgttttattgccggggcggag
ttcgatccgctgctggatgacagccgtctgctttactag

DBGET integrated database retrieval system