KEGG   Shigella flexneri 2457T (serotype 2a): S0588Help
Entry
S0588             CDS       T00128                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00020  Citrate cycle (TCA cycle)
sfx00190  Oxidative phosphorylation
sfx00650  Butanoate metabolism
sfx01100  Metabolic pathways
sfx01110  Biosynthesis of secondary metabolites
sfx01120  Microbial metabolism in diverse environments
sfx01130  Biosynthesis of antibiotics
sfx01200  Carbon metabolism
Module
sfx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sfx_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    S0588 (sdhD)
   00650 Butanoate metabolism
    S0588 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    S0588 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AAP16092
UniProt: P0AC46
Position
complement(597244..597591)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgaactgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system