KEGG   Shigella flexneri 2457T (serotype 2a): S0733Help
Entry
S0733             CDS       T00128                                 

Definition
endolysin R of prophage CP-933V
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Brite
Enzymes [BR:sfx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     S0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
719835..720368
Genome map
AA seq 177 aa AA seqDB search
MSAKIKYGLSAAVLALIAAGASAPQILDQFLNEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDVGRDCRIRSNNCYGQVIRRDQESALACWGIDQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaaaatcaaatacggcctgtcggctgctgttctggcgctgattgccgcaggc
gcgtctgctccccagatacttgaccagtttctgaacgaaaaagagggtaatcacacaacg
gcataccgtgatggttctggcatatggaccatctgtcgtggtgccacaatggtggatggt
aagcctgtcataccgggaatgaagctgtcgaaggaaaaatgtgaccaggttaacgctatt
gaacgtgataaggcgctggcatgggtggagcgcaatattaaagtacctctgaccgaaccc
cagaaagcgggtatagcgtcattttgcccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgccggtgatcgtaagggcgcatgcgaggcgattcgc
tggtggataaaagatgttgggcgcgattgccgcatacgttcaaataactgctatggacag
gttattcgtcgtgaccaggaaagcgcattagcctgttgggggatagatcaatga

DBGET integrated database retrieval system