KEGG   Shigella flexneri 2457T (serotype 2a): S0944Help
Entry
S0944             CDS       T00128                                 

Definition
lysozyme protein R of prophage CP-933K
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
927343..927771
Genome map
AA seq 142 aa AA seqDB search
MSPSLRKAVAVAIGGGAVAIASVLITGPGGNDGLEGVSYIPYKDIIGVWTVCHGHTGKDI
MPGKTYTEAECKALLNKDLVTVARQINPYIKVDIPETTVSAPSATSCENCPVWQQSRPSI
LMDTNDEFPDNKRYSLLPFLFA
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcattacgcaaggctgttgcagttgctattggtggcggggctgttgctata
gcatctgtgttaatcactggcccaggtggtaacgatggtctggaaggtgtcagctacata
ccatacaaagatatcattggtgtatggactgtatgtcacggacacaccggaaaagacatc
atgcctggtaaaacgtataccgaagcagaatgcaaagctctcctgaataaagaccttgtc
actgtcgccagacaaattaacccgtacatcaaagtcgatataccggaaacaacggtaagc
gccccatcagcgacgtcttgtgaaaattgtcctgtctggcaacaatcgcgcccatctata
ttgatggacacgaacgatgaattcccagacaacaaaagatattccctgcttccgttctta
tttgcctga

DBGET integrated database retrieval system