KEGG   Shigella flexneri 2457T (serotype 2a): S1183Help
Entry
S1183             CDS       T00128                                 

Gene name
holB
Definition
DNA polymerase III subunit delta' (EC:2.7.7.7)
Orthology
K02341  
DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sfx00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sfx00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:sfx03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:sfx03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sfx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1146370..1147374
Genome map
AA seq 334 aa AA seqDB search
MRWYPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCG
HCRGCQLMQAGTHPDYYTLAPEKGKNTLGIDAVREVTEKLNEHARLGGAKVVWVTDAALL
TDAAANALLKTLEEPPAETWFFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWLSREV
TMSQDALLAALRLSAGSPGAALALFQGDNWQARETLCQALAYSVPSGDWYSLLAALNHEQ
APARLHWLATLLMDALKRHHGAAQVTNVDVPGLVAELANHLSPSRLQAILGDVCHIREQL
MSVTGINRELLITDLLLRIEHYLQPGVVLPVPHL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagatggtatccatggttacgacctgatttcgaaaaactggtagccagctatcaggcc
ggaagaggtcaccatgcgctactcattcaggcgttaccgggcatgggcgatgatgcttta
atctacgccctgagccgttatttactctgccaacaaccgcagggccacaaaagttgcggt
cactgtcgtggatgtcagttgatgcaggctggcacgcatcccgattactacaccctggct
cccgaaaaagggaaaaatacgctgggcattgatgcggtacgtgaggtcaccgaaaagctg
aatgagcacgcacgcctaggtggtgcgaaagttgtctgggtaaccgatgctgccttactg
accgacgccgcggctaacgcattgctgaaaacgcttgaagagccaccagcagaaacctgg
tttttcctggctacccgcgagcctgaacgtttactggcaacattacgtagtcgttgtcgg
ttacattaccttgcgccgcctccagaacagtacgccgtgacttggctttcacgcgaagtg
acaatgtcacaggatgcattacttgccgcattgcgcttaagcgccggttcgcctggcgcg
gcactggcgttgtttcagggagataactggcaggctcgtgaaacattgtgtcaggcgttg
gcatatagcgtgccatcgggcgactggtattcgctgctggcggcccttaatcatgaacaa
gctccggcgcgtttacactggctggcaacgttgctgatggatgcgctaaaacgccatcat
ggcgctgcgcaggtgaccaatgttgatgtgccgggcctggtcgccgaactggcaaaccat
ctttctccctcgcgcctgcaggctatactgggggatgtttgccacattcgtgaacagtta
atgtctgtcacaggcatcaaccgcgagcttctcatcaccgatcttttactgcgtattgag
cattacctgcaaccgggcgttgtgttaccggttcctcatctttaa

DBGET integrated database retrieval system