KEGG   Shigella flexneri 2457T (serotype 2a): S1183Help
Entry
S1183             CDS       T00128                                 

Gene name
holB
Definition
DNA polymerase III subunit delta' (EC:2.7.7.7)
Orthology
K02341  
DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    S1183 (holB)
   00240 Pyrimidine metabolism
    S1183 (holB)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    S1183 (holB)
   03430 Mismatch repair
    S1183 (holB)
   03440 Homologous recombination
    S1183 (holB)
Enzymes [BR:sfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     S1183 (holB)
DNA replication proteins [BR:sfx03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     S1183 (holB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1146370..1147374
Genome map
AA seq 334 aa AA seqDB search
MRWYPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCG
HCRGCQLMQAGTHPDYYTLAPEKGKNTLGIDAVREVTEKLNEHARLGGAKVVWVTDAALL
TDAAANALLKTLEEPPAETWFFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWLSREV
TMSQDALLAALRLSAGSPGAALALFQGDNWQARETLCQALAYSVPSGDWYSLLAALNHEQ
APARLHWLATLLMDALKRHHGAAQVTNVDVPGLVAELANHLSPSRLQAILGDVCHIREQL
MSVTGINRELLITDLLLRIEHYLQPGVVLPVPHL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagatggtatccatggttacgacctgatttcgaaaaactggtagccagctatcaggcc
ggaagaggtcaccatgcgctactcattcaggcgttaccgggcatgggcgatgatgcttta
atctacgccctgagccgttatttactctgccaacaaccgcagggccacaaaagttgcggt
cactgtcgtggatgtcagttgatgcaggctggcacgcatcccgattactacaccctggct
cccgaaaaagggaaaaatacgctgggcattgatgcggtacgtgaggtcaccgaaaagctg
aatgagcacgcacgcctaggtggtgcgaaagttgtctgggtaaccgatgctgccttactg
accgacgccgcggctaacgcattgctgaaaacgcttgaagagccaccagcagaaacctgg
tttttcctggctacccgcgagcctgaacgtttactggcaacattacgtagtcgttgtcgg
ttacattaccttgcgccgcctccagaacagtacgccgtgacttggctttcacgcgaagtg
acaatgtcacaggatgcattacttgccgcattgcgcttaagcgccggttcgcctggcgcg
gcactggcgttgtttcagggagataactggcaggctcgtgaaacattgtgtcaggcgttg
gcatatagcgtgccatcgggcgactggtattcgctgctggcggcccttaatcatgaacaa
gctccggcgcgtttacactggctggcaacgttgctgatggatgcgctaaaacgccatcat
ggcgctgcgcaggtgaccaatgttgatgtgccgggcctggtcgccgaactggcaaaccat
ctttctccctcgcgcctgcaggctatactgggggatgtttgccacattcgtgaacagtta
atgtctgtcacaggcatcaaccgcgagcttctcatcaccgatcttttactgcgtattgag
cattacctgcaaccgggcgttgtgttaccggttcctcatctttaa

DBGET integrated database retrieval system