KEGG   Shigella flexneri 2457T (serotype 2a): S1349Help
Entry
S1349             CDS       T00128                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00260  Glycine, serine and threonine metabolism
sfx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfx01100  Metabolic pathways
sfx01110  Biosynthesis of secondary metabolites
sfx01130  Biosynthesis of antibiotics
sfx01230  Biosynthesis of amino acids
Module
sfx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    S1349 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    S1349 (trpA)
Enzymes [BR:sfx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     S1349 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AAP16761
UniProt: P0A878
Position
complement(1312603..1313409)
Genome map
AA seq 268 aa AA seqDB search
MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK
VGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKVFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccagttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcacgctcggtgatccgggcattgagcagtcattgaaaattatcgatacgcta
attgaagccggtgctgacgcgctggagttaggtatccccttctccgacccactggcggat
ggcccgaccattcaaaacgccactctgcgcgcctttgcggcaggtgtgactccggcacaa
tgttttgaaatgctggcactgattcgccagaaacacccgaccattcccattggcctgttg
atgtatgccaatctggtgtttaacaaaggcattgatgagttttatgcccagtgcgagaaa
gtcggcgtcgattcggtgctggttgccgatgtgccagttgaagagtccgcgcccttccgc
caggccgcgttgcgccataatgtcgcacctatcttcatctgcccgccaaatgccgatgac
gacctgctgcgccagatagcctcttacggtcgtggttacacatatttgctgtcacgagcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggttgcgaagctg
aaagagtacaacgctgcacctccattgcaggggtttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggccattgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagtttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system