KEGG   Shigella flexneri 2457T (serotype 2a): S1880Help
Entry
S1880             CDS       T00128                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    S1880 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S1880 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    S1880 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    S1880 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    S1880 (adhP)
   00626 Naphthalene degradation
    S1880 (adhP)
Enzymes [BR:sfx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     S1880 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1821368..1822378
Genome map
AA seq 336 aa AA seqDB search
MKTAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMEEE
CIVVADYAVKVPDGLDSAAPSSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMDADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagttggcccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttttacgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggaggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcgccc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaaactgtcaaaaattcgt
cccggtcagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcaaagaatgtctttaacgccaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatggatgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcagtagctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgtcttgtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgtcactaa

DBGET integrated database retrieval system