KEGG   Shigella flexneri 2457T (serotype 2a): S1905Help
Entry
S1905             CDS       T00128                                 

Definition
gamma-aminobutyraldehyde dehydrogenase
Orthology
K00137  
aminobutyraldehyde dehydrogenase [EC:1.2.1.19]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Arginine and proline metabolism
beta-Alanine metabolism
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sfx00330]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:sfx00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1847867..1849291)
Genome map
AA seq 474 aa AA seqDB search
MQHKLLINGERVSGEGEKQPVYNPATGDVLLEIAEVSAEQVDAAVRAADAAFAEWGQTTP
KARAECLLKLADVIEENGQVFAELESRNCGKPLHSAFNDEIPAIVDVFRFFAGAARCLNG
LAAGEYLEGHTSMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEITPLT
ALKLAELAKDIFPAGVINILFGRGKTVGDPLTGHPKVRMVSLTGSIATGEHIISHTASSI
KRTHMELGGKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKL
GAAVATLKSGAPDDESTELGPLSSLAHLERVSKAVEEAKATGHIKVITGGEKRKGNGYYY
APTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLASSVWTKDVGRAHR
VSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSLYGLEDYTVVRHVMVKH
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcaacataagttactgattaacggagaacgggttagcggcgaaggggaaaaacagcct
gtctataatccggcaacgggggacgttttactggagattgccgaggtatccgcagagcag
gtcgatgctgctgtgcgtgcggcagatgcagcatttgctgaatgggggcaaaccacaccg
aaagcgcgtgcggaatgcctgctgaaactggcggatgttatcgaagaaaatggtcaggtt
tttgccgaactggaatcccgtaattgtggcaaaccgctgcatagtgcgttcaatgatgaa
atcccggcgattgtcgatgtttttcgctttttcgcgggtgcggcgcgctgtctgaatggt
ctggcggcaggtgaatatcttgaaggtcatacttcgatgatccgtcgcgatccgttgggg
gtcgtggcttctatcgcaccgtggaattatccgctgatgatggccgcgtggaaacttgct
ccggcgctggcggcagggaactgcgtagtgcttaaaccatcagaaattaccccgctgacc
gcgttgaagttggcagagctggcgaaagatatcttcccggcaggcgtgattaacatactg
tttggcagaggcaaaacggtgggtgatccgctgaccggtcatcccaaagtgcggatggtg
tcgctgacgggctctatcgccaccggcgagcacatcatcagccataccgcgtcgtccatt
aagcgtactcatatggaacttggtggcaaagcgccagtgattgtttttgatgatgcggat
attgaagcagtggtcgaaggtgtacgtacatttggctattacaatgctggacaggattgt
actgcggcttgtcggatctacgcgcaaaaaggcatttacgatacgctggtggaaaaactg
ggtgctgcggtggcaacgttaaaatctggtgcgccggatgacgagtctacggagcttgga
cctttaagctcgctggcgcatctcgaacgcgtcagcaaggcagtagaagaggcgaaagcg
acagggcacatcaaagtgatcactggcggtgaaaagcgcaagggtaatggctattactat
gcgccgacgctgctggctggcgcattacaggacgatgccatcgtgcaaaaagaggtattt
ggtccagtagtgagtgttacgcccttcgacaacgaagaacaggtggtgaactgggcgaat
gacagccagtacggacttgcatcttcggtatggacgaaagatgtgggcagggcgcatcgc
gtcagcgcacggctgcaatatggttgtacctgggtcaatacccatttcatgctggtaagt
gaaatgccgcacggtgggcagaaactttctggttacggcaaggatatgtcactttatggg
ctggaggattacaccgtcgtccgccacgtcatggttaaacattaa

DBGET integrated database retrieval system