KEGG   Shigella flexneri 2457T (serotype 2a): S2228Help
Entry
S2228             CDS       T00128                                 

Gene name
galF
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalF (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    S2228 (galF)
   00052 Galactose metabolism
    S2228 (galF)
   00500 Starch and sucrose metabolism
    S2228 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    S2228 (galF)
Enzymes [BR:sfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     S2228 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2101928..2102821)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVIIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaaaagcagttattcctgtagcgggtctcgggatgcatatgttgcctgcc
actaaggcgatacccaaagagatgctaccaatcgtcgacaagccaatgattcagtacatt
gttgacgagattgtggctgcagggatcaaagaaatcctcctggtaactcacgcgtccaag
aacgcggtcgaaaaccacttcgacacctcttatgagttagaatcactccttgagcagcgc
gtgaagcgtcaactgctggcggaagtacagtccatctgtccgccgggcgtgatcattatg
aacgtgcgtcagggcgaacctttaggtttaggccactccattttgtgtgcgcgacctgcc
attggtgacaacccatttgtcgtggtactgccagacgttgtgatcgacgatgccagcgcc
gacccgctacgttacaaccttgctgccatgattgcacgtttcaacgaaacgggccgcagc
caggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtcatccagactaaa
gagccgctggaccgtgagggtaaagtcagccgcattgttgaatttatcgaaaaaccggat
cagccgcagacgctggactcagacatcatggccgtaggtcgctatgtgctttctgccgat
atttggccggaactggaacgtactcagcctggtgcatggggacgtattcagctgactgat
gctattgccgagctggcgaaaaaacaatccgttgatgcaatgctgatgaccggcgacagt
tacgactgcggcaaaaaaatgggctatatgcaggcgtttgtgaagtatggcctacgcaac
ctgaaagaaggggcgaagttccgtaaaggtattgagaagctgttaagcgaataa

DBGET integrated database retrieval system