KEGG   Shigella flexneri 2457T (serotype 2a): S2513Help
Entry
S2513             CDS       T00128                                 

Gene name
yfcG
Definition
(GenBank) putative S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Brite
Enzymes [BR:sfx01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     S2513 (yfcG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2408190..2408837
Genome map
AA seq 215 aa AA seqDB search
MIDLYFAPTPNGHKITLFLEEAELDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSP
ADGGEPLSLFESAAILLYLAEKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNH
AAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYSIADIACWPWVNAWTRLRIDL
AMYPAVKNWHERIRSRPATGQALLKAQLGDERSDS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctctatttcgccccgacacccaatggtcacaaaattacgctgtttctcgaa
gaagcagagcttgattatcgcttgattaaggtagacttggggaaaggcggtcagtttcgt
ccggaatttttgcgcatttcgcccaacaacaaaattccggcaattgttgatcattctcct
gccgatggcggcgaaccgttaagcctctttgagtctgctgccattttgttgtatctggct
gagaaaacaggactctttttgagtcatgaaacgcgtgagcgcgccgccacattacagtgg
ttattctggcaggtaggcggactggggccgatgcttgggcaaaatcatcattttaatcac
gcagccccccaaaccattccttacgctattgaacgttatcaggttgaaactcagcgtctt
taccatgtactaaacaagcggctggaaaactcgccctggctgggaggcgagaactacagc
attgcggatattgcctgctggccgtgggttaatgcctggactcgcctgcgaattgacctc
gcaatgtatccggcagtcaagaactggcatgagcggatccgttcgcgccctgccaccggg
caggcactgctaaaagcacaactcggtgatgagcgttcggatagttaa

DBGET integrated database retrieval system