KEGG   Shigella flexneri 2457T (serotype 2a): S3129Help
Entry
S3129             CDS       T00128                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    S3129 (speB)
Enzymes [BR:sfx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     S3129 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3012114..3013034)
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNH
SVQIGIRTEFDKDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttaggtcatcaatacgataactcactggtttccaatgcctttggtttttta
cgcctgccgatgaacttccagccgtatgacagcgatgcagactgggtgattactggcgtg
ccgttcgatatggccacttctggtcgtgcgggtggtcgccacggtccggcagcgatccgt
caggtttcgacgaatctggcctgggaacacaaccgcttcccgtggaatttcgacatgcgt
gagcgtctgaacgtcgtggactgcggcgatctggtatatgcctttggcgatgcccgtgag
atgagcgaaaagctgcaggcgcacgccgagaagctgctggctgccggtaagcgtatgctc
tccttcggtggtgaccactttgttacgctgccgctgctgcgtgctcatgcgaagcatttc
ggcaaaatggcgctggtacactttgacgcccacaccgatacctatgcgaacggttgtgaa
tttgaccacggcactatgttctataccgcgccgaaagaaggtctgatcgacccgaatcat
tccgtgcagattggtattcgtaccgagtttgataaagacaacggctttaccgtgctggac
gcctgccaggtgaacgatcgcagcgtggatgacgttatcgcccaggtgaaacagattgtg
ggtgatatgccggtttacctgacttttgatatcgactgcctggatcctgctttcgcgccg
ggaaccggtacgccagtgattggcggcctgacctccgatcgcgccattaaactggtacgc
ggcctgaaagatctcaacatcgttgggatggacgtagtggaagtggctccggcatacgat
cagtcggaaatcaccgctctggctgcggcgacgctggcgctggagatgctgtatattcag
gcggcgaaaaagggcgagtaa

DBGET integrated database retrieval system