KEGG   Shigella flexneri 2457T (serotype 2a): S3435Help
Entry
S3435             CDS       T00128                                 

Gene name
folP
Definition
(GenBank) 7,8-dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00790  Folate biosynthesis
sfx01100  Metabolic pathways
Module
sfx_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    S3435 (folP)
Enzymes [BR:sfx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     S3435 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AAP18497
UniProt: P0AC15
Position
complement(3307363..3308256)
Genome map
AA seq 297 aa AA seqDB search
MLRGFFLSIHTRDNIMKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHAN
LMINAGATIIDVGGESTRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRE
SAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYF
IEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIG
QLLNVGPSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgctccggggttttttcttatcaattcataccagggataacataatgaaactctttgcc
cagggtacttcactggaccttagccatcctcacgtaatggggatcctcaacgtcacgcct
gattccttttcggatggtggcacgcataactcgctgatagatgcggtgaaacatgcgaat
ctgatgatcaatgctggcgcgacgatcattgacgttggtggcgagtccacgcgcccaggg
gcggcggaagttagcgttgaagaagagttgcaacgtgttattcctgtggttgaggcaatt
gctcaacgcttcgaagtctggatctcggtcgatacatccaaaccagaagtcatccgtgag
tcagcgaaagttggcgctcacattattaatgatatccgctccctttccgaacctggcgct
ctggaggcggctgcagaaaccggtttaccggtttgtctgatgcatatgcagggaaatcca
aaaaccatgcaggaagctccgaagtatgacgatgtctttgcagaagtgaatcgctacttt
attgagcaaatagcacgttgcgagcaggcgggtatcgcaaaagagaaattgttgctcgac
cccggattcggtttcggtaaaaatctctcccataactattcattactggcgcgcctggct
gaatttcaccatttcaacctgccgctgttggtgggtatgtcacgaaaatcgatgattggg
cagctgctgaacgtggggccgtccgagcgcctgagcggtagtctggcctgtgcggtcatt
gccgcaatgcaaggcgcgcacatcattcgtgttcatgacgtcaaagaaaccgtagaagcg
atgcgggtggtggaagccactctgtctgcaaaggaaaacaaacgctatgagtaa

DBGET integrated database retrieval system