KEGG   Shigella flexneri 2457T (serotype 2a): S3753Help
Entry
S3753             CDS       T00128                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    S3753 (pfkA)
   01230 Biosynthesis of amino acids
    S3753 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    S3753 (pfkA)
   00030 Pentose phosphate pathway
    S3753 (pfkA)
   00051 Fructose and mannose metabolism
    S3753 (pfkA)
   00052 Galactose metabolism
    S3753 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    S3753 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    S3753 (pfkA)
Enzymes [BR:sfx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     S3753 (pfkA)
Protein phosphatases and associated proteins [BR:sfx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     S3753 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3649722..3650666)
Genome map
AA seq 314 aa AA seqDB search
MLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDMINRGG
TFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCIGLPGT
IDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAAAIAGG
CEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETGRETRAT
VLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDAIENMKR
PFKGDWLDCAKKLY
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgttgacaagcggcggtgatgcgccaggcatgaacgccgcaattcgcggggttgttcgt
tctgcgctgacagaaggtctggaagtaatgggtatttatgacggctatctgggtctgtat
gaagaccgtatggtacagctagaccgttacagcgtgtctgacatgatcaaccgtggcggt
acgttcctcggttctgcgcgtttcccggaattccgcgacgagaacatccgcgccgtggct
atcgaaaacctgaaaaaacgtggtatcgacgcgctggtggttatcggcggtgacggttcc
tacatgggtgcaatgcgtctgaccgaaatgggcttcccgtgcatcggtctgccgggcact
atcgacaacgacatcaaaggcactgactacactatcggtttcttcactgcgctgagcacc
gttgtagaagcgatcgaccgtctgcgtgacacctcttcttctcaccagcgtatttccgtg
gtggaagtgatgggccgttattgtggcgatctgaccctggctgcggccattgccggtggc
tgtgaattcgttgtagttccggaagttgaattcagccgtgaagacctggtaaacgaaatc
aaagcgggtatcgcgaaaggtaaaaaacacgcgatcgtggcgattaccgaacatatgtgt
gatgttgacgaactggcgcatttcatcgagaaagaaaccggtcgtgaaacccgcgcaact
gtgctgggccacatccagcgcggtggttctccggtgccttacgaccgtattctggcttcc
cgtatgggcgcttacgctatcgatctgctgctggcaggttacggcggtcgttgtgtaggt
atccagaacgaacagctggttcaccacgacatcatcgacgctatcgaaaacatgaagcgt
ccgttcaaaggtgactggctggactgcgcgaaaaaactgtattaa

DBGET integrated database retrieval system