KEGG   Shigella flexneri 2457T (serotype 2a): S3898Help
Entry
S3898             CDS       T00128                                 

Gene name
rffG
Definition
dTDP-glucose 4,6-dehydratase
Orthology
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    S3898 (rffG)
   01055 Biosynthesis of vancomycin group antibiotics
    S3898 (rffG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    S3898 (rffG)
Enzymes [BR:sfx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     S3898 (rffG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3791140..3792207)
Genome map
AA seq 355 aa AA seqDB search
MRKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDI
CDRAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLT
EDKKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGL
PTLITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVA
TTGKVGETYNIGGHNERKNLDVVETICELLEELASNKPHGVAYYRDLITFVADRPGHDLR
YAIDASKIARELGWLPQETFESGMRKTVQWYLANESWWKQVQDGSYQGERLGLKG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattctgataacaggtggtgccgggtttattggctcggcgctggtgcgttat
atcatcaacgaaacgagcgatgcggtggtagtggtcgataagctgacctacgccggaaac
ctgatgtcgctggcaccggtcgcgcaaagcgagcgctttgcctttgagaaagttgatatc
tgcgatcgggcagaactggcacgcgtattcactgagcatcagccagactgtgtcatgcat
ctggcagccgaaagccatgttgaccgttctattgacggcccggcagcgtttattgaaacc
aacattgtcgggacttatacattgcttgaagcggcgcgggcttactggaatacgctgacg
gaagataaaaaatcagcgttccgttttcatcatatctccaccgacgaagtatatggtgac
ctgcactcgacggatgatttcttcaccgaaaccacgccgtatgcgccgagcagcccttat
tccgcgtcaaaagccagcagcgaccatctggtgcgcgcctggctgcggacctacggtctg
ccgacgctgatcaccaactgctcgaataactacggtccttaccactttccggaaaaactg
atcccgctgatgatcctcaacgcgctggcgggtaaaccgctgccggtatatggcaacggg
cagcaaatccgtgactggctgtatgtggaagatcacgcccgcgcgctgtattgcgtggcg
accaccgggaaagtcggtgaaacctataatattggtggtcacaacgagcgtaagaatctc
gatgttgtggaaaccatttgcgagctgctggaagaactggcttcgaacaagccgcacggc
gtggcgtactatcgtgacctgatcacctttgtcgctgaccgtccggggcatgatctgcgt
tatgccattgatgcttcgaaaattgcccgtgaacttggctggctgccgcaggaaaccttt
gaaagtggaatgcgtaaaacggttcagtggtatctggctaatgaaagctggtggaagcag
gtgcaggacggcagctatcagggtgagcgtttaggtctgaaaggctaa

DBGET integrated database retrieval system