KEGG   Shigella flexneri 2457T (serotype 2a): S3898Help
Entry
S3898             CDS       T00128                                 

Gene name
rffG
Definition
dTDP-glucose 4,6-dehydratase
Orthology
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sfx00523]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of vancomycin group antibiotics
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sfx00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3791140..3792207)
Genome map
AA seq 355 aa AA seqDB search
MRKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDI
CDRAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNTLT
EDKKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGL
PTLITNCSNNYGPYHFPEKLIPLMILNALAGKPLPVYGNGQQIRDWLYVEDHARALYCVA
TTGKVGETYNIGGHNERKNLDVVETICELLEELASNKPHGVAYYRDLITFVADRPGHDLR
YAIDASKIARELGWLPQETFESGMRKTVQWYLANESWWKQVQDGSYQGERLGLKG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattctgataacaggtggtgccgggtttattggctcggcgctggtgcgttat
atcatcaacgaaacgagcgatgcggtggtagtggtcgataagctgacctacgccggaaac
ctgatgtcgctggcaccggtcgcgcaaagcgagcgctttgcctttgagaaagttgatatc
tgcgatcgggcagaactggcacgcgtattcactgagcatcagccagactgtgtcatgcat
ctggcagccgaaagccatgttgaccgttctattgacggcccggcagcgtttattgaaacc
aacattgtcgggacttatacattgcttgaagcggcgcgggcttactggaatacgctgacg
gaagataaaaaatcagcgttccgttttcatcatatctccaccgacgaagtatatggtgac
ctgcactcgacggatgatttcttcaccgaaaccacgccgtatgcgccgagcagcccttat
tccgcgtcaaaagccagcagcgaccatctggtgcgcgcctggctgcggacctacggtctg
ccgacgctgatcaccaactgctcgaataactacggtccttaccactttccggaaaaactg
atcccgctgatgatcctcaacgcgctggcgggtaaaccgctgccggtatatggcaacggg
cagcaaatccgtgactggctgtatgtggaagatcacgcccgcgcgctgtattgcgtggcg
accaccgggaaagtcggtgaaacctataatattggtggtcacaacgagcgtaagaatctc
gatgttgtggaaaccatttgcgagctgctggaagaactggcttcgaacaagccgcacggc
gtggcgtactatcgtgacctgatcacctttgtcgctgaccgtccggggcatgatctgcgt
tatgccattgatgcttcgaaaattgcccgtgaacttggctggctgccgcaggaaaccttt
gaaagtggaatgcgtaaaacggttcagtggtatctggctaatgaaagctggtggaagcag
gtgcaggacggcagctatcagggtgagcgtttaggtctgaaaggctaa

DBGET integrated database retrieval system