KEGG   Streptococcus gallolyticus UCN34: GALLO_0006Help
Entry
GALLO_0006        CDS       T01171                                 

Gene name
pth
Definition
peptidyl-tRNA hydrolase
Orthology
K01056  
peptidyl-tRNA hydrolase, PTH1 family [EC:3.1.1.29]
Organism
sga  Streptococcus gallolyticus UCN34
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5367..5936
Genome map
AA seq 189 aa AA seqDB search
MVKMIVGLGNPGSKYHETRHNIGFMAIDRLAKDFNVTFSEEKNFKAEVGSCFINGEKVYL
VKPTTFMNNSGIAVHALLTYYNIDIEDFLVIYDDLDMEVGRIRLRQKGSAGGHNGIKSII
AHTGTQAFDRIKVGIGRPKQGRSVVDHVLGKFDQDDYITVTNTLEKVNEAVQFYLQEADF
VKTMQKFNG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaatgattgttggtctgggaaacccaggcagtaaatatcacgaaacaaggcat
aatattggttttatggcaattgaccgccttgctaaggatttcaatgtcacattttcagag
gaaaagaattttaaagcagaagttggttcttgttttatcaacggagaaaaagtttatcta
gtcaaaccaaccacttttatgaacaattccggcatcgctgttcatgctttgttgacgtat
tataatattgatattgaagatttcttggtgatttatgatgatttagatatggaagtgggg
cgtattcgcctacgtcagaaaggctctgctggtgggcataatggcataaaatctatcatt
gctcacactggaacgcaggcatttgaccgtattaaagttggtattggacgtccaaagcaa
ggtcgttcggtagttgaccatgttcttggaaaatttgaccaagatgattatattacagtt
actaatacacttgaaaaggttaatgaagctgttcaattttatttacaggaagcagatttt
gtaaaaaccatgcaaaaatttaatgggtaa

DBGET integrated database retrieval system