KEGG   Streptococcus gallolyticus UCN34: GALLO_0042Help
Entry
GALLO_0042        CDS       T01171                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GALLO_0042 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GALLO_0042 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GALLO_0042 (thrC)
Enzymes [BR:sga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GALLO_0042 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54920..56404
Genome map
AA seq 494 aa AA seqDB search
MTLIYQSTRDENNKVTASQAILQGLATDGGLFTPVSLPEVALDFETLKDASYQEVAKLVL
SAFLDDFTEEELAYCIDSAYDAKFDTPEIAPLVKLGDQYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKIQELQMT
TQTGDNTHVVAITGNFDDAQTDVKRMFNDVDLREKLLAHKTQFSSANSMNVGRLVPQVVY
YVYAYAQLVKAGHIKAGDKVNFTVPTGNFGNILAAYYASQIGVPVGKLICASNENKVLTD
FFTTGTYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNDAAKTKALMEQLVSEGEYTLP
DVDQSILDLFEAGYATEVETSAEIKRVYEASDYIEDPHTAVASAVYQKYAERTGDKTPTV
IASTASPYKFPRVAVEAVSGQAPADDFVAVKELEKLSGVAIPKAVNGLETAEVRHKTVVA
TGDMQKAVENYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaatttaccaatcaactcgtgatgaaaataacaaagtaactgctagtcaagct
atcttacaaggattggcaactgacggtggtttatttacccctgtatcacttccagaagtg
gcattggattttgagactttaaaagacgcttcttaccaagaagtggctaagcttgtattg
tctgcatttttagacgatttcacagaagaagagttggcttactgtattgattctgcttac
gatgctaaatttgatacaccagaaatcgcaccgctggttaaattaggtgaccaatataac
cttgaacttttccatgggtcaactattgcgtttaaagacatggcattgtcaatcttgcca
taccttttgacaacgtcagctaaaaaacaaggcgttgataacaaaatcgtgattttgaca
gcgacatcaggtgatactggtaaagctgcaatggctggttttgcggatgtcccaggaaca
gaaatcattgttttctatccaaaagacggtgtcagcaaaattcaagagcttcagatgaca
acacaaactggtgataacacacacgttgtagccattactggtaactttgatgatgcgcaa
acagatgtaaaacgtatgtttaacgacgttgatttgcgtgaaaaattgcttgcgcacaag
acacaattttcatcagcaaactcaatgaatgttgggcgtttggtaccacaagttgtttat
tatgtttatgcttatgcacaacttgttaaagctggtcatattaaagcaggcgacaaagta
aactttacagttccaacaggaaactttggtaacattctagcagcttactacgcaagtcaa
atcggtgtcccagttggtaaattaatctgtgcttcaaatgaaaacaaagttttaacagac
ttcttcacaacagggacttatgataaaaaacgtgagtttaaagtcacaacaagtccttca
atggatatcttggtatcatctaacttagaacgtttgattttccatttgttgggaaatgat
gctgctaagacgaaagcattgatggaacaattggtttcagagggcgaatacacacttcct
gatgttgaccaatcgattcttgatttatttgaagcaggctatgcaacagaagttgaaacg
tctgctgaaatcaaacgtgtctatgaagcatctgattacattgaggacccacatacggca
gttgcgtcagctgtttatcaaaaatacgcagagcgcacaggtgataaaacaccaactgtg
attgcttcaacagcaagtccatataaattcccacgtgtggcagttgaagctgttagtgga
caagcacctgcagatgattttgttgctgttaaggaacttgaaaaattatcaggtgttgcc
attccaaaagctgtcaatggacttgaaacagctgaggttcgtcacaaaacggttgtggca
acaggtgatatgcaaaaagcagttgaaaattatttaggactttaa

DBGET integrated database retrieval system