KEGG   Streptococcus gallolyticus UCN34: GALLO_0167Help
Entry
GALLO_0167        CDS       T01171                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sga00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sga00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
175361..177592
Genome map
AA seq 743 aa AA seqDB search
MILINEEELSFHLTNGKVSYVFRVMERTGILEQLYCGPAISDYESFTFLIEREIRPGNNL
YMGSSLMSLEHIKQEYPVFGTTDFRYPALEIQYPTGDLISHFRYVGYRIEKGKTVTGALP
GTFGNEEDVETLIVCLKDDYADLELELHYAIYANYPIITRQQKIINKDTQTLSIKRFASF
SLDLPNENYDWVHLDGAWARENHLSRSSIQKGIQNISSTRGHSSHVHNPFLAICSPEATE
NNGQVYGFSLIYSGSFLAQIESDNYNTLRIQMGINPFQFDWQLHPGQLFESPEAVLVVSQ
SGFNGMSQVFHDFYKEHLIRSSWKNKKRPVLLNSWEAMYFDFNQEKILEVAEEASKLGIE
LFVLDDGWFGKRNSDTGSLGNWTENKEKLPDGLAHLAKAIKEKGMLFGLWFEPEMVSDDT
DLFKEHPDWVIGNPEKNISHGRNQFVLDFGNPEVVEAIYNQMAHLLSTVPIDYIKLDMNR
YISESFSSHLPSKQQGEVNHRYILGVYSLYEKLNQAFPDVLIESCAGGGARFDPGMLYYS
PQIWTSDDTDAVERLTIQWGTSMVYPLSTMSAHVSAVPNHQVARVTSLDMRKDVAMFGVF
GYELNPLALTEEEKEAVKAQIKEYHTYQELIQNGIFYRLDLTDKNHVGWLVVNKERTEAL
VGYYTILAQPNPIYERLKLVGLNPDKAYHILGKDKDEVRYGRDLASIGIILGKNYIGRES
EYWSREMPGDFNGKIYYLQQIDK
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgattctcattaatgaggaagaactttcttttcatttgaccaatgggaaagtatcgtat
gtgtttagagtaatggagagaacagggattttagagcaattatattgcggacctgccatt
tctgattacgaatcgtttacctttttgattgagcgtgaaattcgcccaggaaataatctt
tatatggggtcgagcttaatgtcgcttgaacatattaagcaagagtatcccgtatttggg
acgacggattttcgttatcctgctttagaaattcaatatccgacgggagatttgatttca
cattttcgctatgtgggctatcgtattgaaaaaggaaaaacggtaacgggtgctcttcca
gggacttttggaaatgaagaagatgttgaaacgttgattgtttgtttgaaagatgactat
gctgatttagagcttgaattgcattatgcgatttatgcgaattatcctatcattacgcgt
cagcaaaaaatcattaacaaggacacacaaacgctctcgattaaacgttttgctagtttt
agtttagaccttccaaatgagaattatgactgggttcatttagatggtgcttgggcacgt
gaaaatcatttgtcgcgtagttccattcaaaaaggtatccaaaatatttcaagcacgaga
gggcacagcagtcatgttcacaaccctttccttgccatttgttcaccagaagcaaccgaa
aataatggacaagtatatggctttagtttgatttatagtggaagctttttagcccaaatt
gaatccgacaactacaataccctacgcatacaaatgggtattaatcccttccagtttgat
tggcaacttcatccaggacagctgttcgaatctcctgaagctgtcttggttgtgagccag
tcgggctttaatgggatgagtcaggtttttcatgatttttataaagaacatttaatacga
agttcatggaaaaataaaaaacgccctgttttactaaatagttgggaggcgatgtatttc
gattttaatcaagaaaagattttagaagtggctgaggaagccagtaaattaggaattgaa
ctttttgtcttggatgacggttggtttggcaagcgaaatagtgacacaggttcacttggt
aattggacggaaaacaaggaaaaattaccagacggacttgctcatttagctaaggctatc
aaagaaaaaggaatgttgtttggactttggtttgagccagaaatggtctctgatgatact
gatttgtttaaagaacatccagattgggtcattggcaatccagaaaaaaatatttcgcat
ggtcgtaaccaatttgtgcttgattttggcaatccagaagtggttgaagcaatttacaat
caaatggcacatttgttatcaacggtgccgattgattacattaagttagacatgaaccgc
tacatttcagaaagtttttcaagtcatttgccaagtaaacagcaaggtgaggttaaccac
cgttacatcttgggtgtttacagcttgtacgaaaaactaaatcaggcatttcctgatgtt
cttattgaatcttgtgcgggtggcggggcacgttttgaccctggaatgctttattattcg
ccacaaatctggacaagtgatgatacggacgcggtggaacgtttgactattcaatggggg
acttctatggtctatccgttatcaaccatgagtgcccatgtttcagcggtgcctaatcac
caagttgcgcgtgtgacgtcacttgatatgcgaaaagacgttgccatgtttggtgtcttt
ggctacgaattaaatccattagctttgacagaagaggaaaaagaagctgtaaaagcgcag
attaaagaataccatacttatcaagaattgattcaaaatggtattttctatcgcttggat
ttgacggataaaaaccatgtcggctggctggttgtcaataaagaaagaacagaagctttg
gttggctattatacgattttggcgcaaccaaatccaatttacgaacgcttaaaattagtt
ggtctcaaccctgataaagcctatcatattctcggaaaagataaagacgaggtaaggtat
ggacgtgacctagcttctatcggtattattttaggaaaaaattatatcggtagagaaagt
gagtattggtcacgcgaaatgccgggtgattttaacggaaaaatttattatttgcaacaa
attgataaataa

DBGET integrated database retrieval system