KEGG   Streptococcus gallolyticus UCN34: GALLO_0191Help
Entry
GALLO_0191        CDS       T01171                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GALLO_0191
  Lipid metabolism
   00561 Glycerolipid metabolism
    GALLO_0191
   00600 Sphingolipid metabolism
    GALLO_0191
Enzymes [BR:sga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     GALLO_0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
200969..203146
Genome map
AA seq 725 aa AA seqDB search
MGITIKGNLFYIQSKEMSMIIENREGDLLLRHIGGKIANYHGSNAIFEKDHAFSGNPTPD
NRTFSYDTQRQIFGVHGFGDFRCPSLKIQHDNNELTQFKLKDSHILHGVVEATGLPSPHS
MEGAETLVFILEDEFAKLRLTLYYTAYADRATISTFAKISNLSDKAVIINRALSTMLDVP
AGNYDVVTLQGAYAREKTVRRQMVEQGIFSIASNRGASGHAQTPAVILCDRTATEDAGSA
LALQLLYSGNFQAFVQKNQLNEVRLGIGINDDNFAWQLAARDNFETPVALMTYSAKGLTH
LSQESQLFVQNHIMPKQFAHVERPILINNWEATYFAFKQEKLLDLVDEASRLGIELFVLD
DGWFGNRFDDNRALGDWGVNEEKLGGPLSDLIDKVHAKGLKFGLWFEPEMISVDSDLYRT
HPDWAIQAEGRAHTYSRNQLVLNLANPDVVAYIKLAIDKILTENAIDYVKWDYNRNITNI
GNGDSALATKMQSHAYMLGLYDLVSYLTGKHSNILFESCSGGGGRNDLGMMRYFPQVWAS
DNTDAISRLQIQYGSSYLYPTISMGSHVSASPNHQMGRTTPIETRGNVAMMGNLGYELDL
TSLPESEKEVIATQVSHYKDIRPVVQFGKHYRLINPEQGANEAAVQFVYEDKVVVTYVRT
LSMIETIETTLKLKGLEEADTYRLQETGQVFSGAELMYAGLTVTLPQGDYLSKQYYFVKQ
KGGFQ
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgggaattacaatcaaaggaaatcttttctatattcagagtaaagagatgtcaatgatt
attgagaatcgagaaggtgatttacttcttcgtcatattgggggtaaaatcgctaactat
cacggttcaaatgcgatatttgagaaagatcatgctttttcaggcaatccgactcccgat
aatcgtacgtttagctatgatacccaacgtcaaatctttggtgtgcatggctttggtgat
tttcgttgcccatcacttaaaattcaacatgataacaatgaattaacacaatttaagtta
aaagatagtcatattttacatggagttgttgaggcaacaggattacctagtcctcattca
atggaaggtgctgaaacattagtgtttatcttagaagatgaatttgctaaattgcgtctg
acgctttattacacagcttatgcagatcgtgcaactatttcaacctttgctaagattagt
aatctatccgataaagctgttatcatcaaccgtgctttatcaactatgcttgatgtacct
gctggaaattatgatgtggtgactttgcaaggagcttatgcgcgtgagaaaacagttcgt
cgtcaaatggtcgagcaaggtatctttagcattgcttcaaatcgcggagcttctggtcat
gctcagactccagctgtgattttgtgtgataggacagcgacggaggatgctggcagtgcc
cttgctttgcagctactttatagtggtaattttcaagcttttgttcaaaaaaatcaattg
aatgaagttcgcttagggattggtattaatgatgataactttgcttggcaattggcagct
agagataattttgaaacgccagtggctttgatgacttattcggcaaaaggtttgacacac
ttgagccaagaaagccagttgtttgtgcaaaatcatatcatgccaaaacaatttgctcat
gttgagcgtccgattcttatcaataactgggaagcgacttattttgctttcaagcaagaa
aaattgcttgatttagttgatgaagcaagcagacttggtattgaactctttgttttagat
gacggttggtttggaaatcgatttgacgataatcgtgcacttggtgactggggtgtcaat
gaagaaaaactcggtggaccattgagtgatttgattgataaagttcatgctaaaggcttg
aaatttggtttgtggtttgaaccggaaatgatttctgtagatagtgacctttaccgtacc
catcctgattgggctattcaagctgagggtcgtgctcatacttattctcgtaatcaattg
gtacttaaccttgccaaccctgatgtggtagcttatattaaattagctatcgataaaatc
ttgacagaaaatgctattgattatgtcaaatgggattataaccgtaacatcacaaatatc
ggaaatggcgactcagctcttgccactaagatgcaatcccatgcatatatgttaggtttg
tatgatttggtatcctatttgactggaaaacatagcaatattctctttgaatcatgctca
ggtggcggtggtcgaaacgaccttggaatgatgcgctacttcccacaagtttgggctagt
gataatacagatgccatttctcgtttgcaaattcaatatggttcaagctatctgtaccca
actatctctatgggttcccatgtttcagcaagcccaaatcaccaaatgggacgcacaaca
ccaattgaaacacgtggaaatgttgctatgatgggaaatcttggctacgaacttgatttg
acaagcctaccagaaagtgaaaaagaagtgattgctactcaggtttctcactacaaagac
attcgtccagttgtccaatttgggaagcattatcgtcttatcaatccagaacaaggcgca
aatgaagcggctgtgcaatttgtctatgaagataaagtcgttgtaacttacgttcgcaca
ctttcaatgattgaaacaattgaaacgacgctaaaactgaaaggtttagaggaagcagat
acctatcgcttacaagaaacaggacaagttttctccggggctgaactcatgtatgcaggt
ttgaccgtaactctcccacaaggtgactatctcagcaaacaatactattttgtgaaacaa
aaaggaggttttcaatga

DBGET integrated database retrieval system