KEGG   Streptococcus gallolyticus UCN34: GALLO_0195Help
Entry
GALLO_0195        CDS       T01171                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GALLO_0195
Enzymes [BR:sga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     GALLO_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206528..207973
Genome map
AA seq 481 aa AA seqDB search
MGIQNKTMLITYSDSLGKNLKELKQNLDKYFGEAVGGIHLLPFFPSTGDRGFAPVDYDEV
DSTFGTWDDVKGLGENYYLMFDFMINHISRQSKYYKDYQEKHEASAYKDMFLNWDKFWPE
NRPTQVDVDLIYKRKDRAPKQEIHFTDGSVEHLWNTFGEEQIDLDVTKEVTMDFIRKTIK
HLAENGCDLIRLDAFAYAVKKLDTNDFFVEPDIWELLDKVRSIAAESGTELLPEIHEHYS
IQFKIAEHDYYVYDFALPMVTLYSLYSRKVDRLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDDEIDYTSSELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDKKYFLARLI
QVFAPGIPQVYYVGFLAGKNDLDLLEKTKEGRNINRHYYTNEEIAEEVRRPVVQALLKLF
TFRNQSAAFDLDGSIDVEILDENTLVITRRNQGSSVVAEAQINLKELSYAVKENGEEVTF
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgggaattcaaaataaaacaatgttaatcacttactcggatagtctgggtaaaaattta
aaagaacttaaacaaaatcttgataagtatttcggggaggcagttggtggtatccatcta
ttgccattctttccgtcaactggtgaccgtggttttgcccctgtcgattatgatgaggta
gattctacatttggtacttgggatgatgtgaaaggcttgggtgaaaactattatcttatg
tttgatttcatgattaaccatatttctcgtcaatcaaaatattacaaagattatcaagaa
aaacatgaagctagtgcttacaaggatatgtttcttaactgggataaattttggccagaa
aatcgtccgacacaagttgatgtggacttgatttacaagcgtaaagaccgcgcaccaaaa
caagaaattcattttacagatggttcggttgagcatttgtggaatacatttggtgaggaa
caaattgaccttgacgtgacaaaagaagtgaccatggatttcattcgaaaaaccatcaaa
cacctagcagaaaatggatgtgacctcattcgtctagatgcatttgcttatgcagttaag
aaattggataccaatgatttctttgtggagccagacatttgggaattacttgataaagtg
cgtagcattgcagcggaatctggtacagaattgcttccagaaattcatgagcactattca
atccagtttaagattgctgagcatgactattatgtctatgattttgcacttccaatggtg
acgctttatagcctatatagcagaaaagttgaccgtttggcaaaatggttgaaaatgtcg
ccgatgaagcaatttacaacgcttgatacacatgatggaattggtgtggttgatgtcaaa
gatattttgacagatgatgaaattgattatacctccagtgaactttataaagttggtgct
aatgtcaaacgtaaatactcatctgctgaatacaataatctcgatatttatcagattaat
tcgacttattattctgcacttggtgatgatgacaagaaatatttcttagcacgcttgatt
caggtttttgccccgggtattccacaagtttattatgttggatttttagcaggaaaaaat
gatcttgatttgttagaaaaaacaaaagaaggccgcaacatcaatcgtcattattacacg
aatgaagaaattgctgaagaagtccgacgcccagtagttcaagctttgctcaaactcttt
acttttcgaaatcaatcagctgcttttgaccttgatggcagtattgatgtagagatatta
gatgaaaatacgcttgtaatcactcgccgtaatcaaggtagcagtgtggttgcggaagcc
caaattaatttaaaagagttaagctacgcagttaaagaaaacggggaagaagttactttc
ttataa

DBGET integrated database retrieval system