KEGG   Streptococcus gallolyticus UCN34: GALLO_0406Help
Entry
GALLO_0406        CDS       T01171                                 

Definition
phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GALLO_0406
Enzymes [BR:sga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     GALLO_0406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
435680..437101
Genome map
AA seq 473 aa AA seqDB search
MVLSENFLWGGATAANQAEGGVLEGGRGLSNVDLLPIGKDRAIISSGEIEHLEWDDNHFY
PAKEAIDMYHHYKDDIKLFAELGFKVYRMSISWTRIFPNGDDEMPNQAGLDFYRGIFEEL
KKYGIEPLVTLAHFDVPVSLIKRYGGWRDRHLVDAYVRYAQTVMTAYKGLVNYWLTFNEI
NILIHSPFVGGGLIFKEGDNKKQLMYQAAHHQLVASSLVTKVAHDIDSENQLGCMLAGGM
HYPYSCRPEDYKEAIDSDRKNYFFIDVQARGYYPNYAKKMFEREQIELEMLDGDLECLKN
TVDFVSFSYYSSRTVSGFEEDYETTTGNLFRSIKNPNLESTEWGWQIDPLGLRNALNQLY
DRYQKPLFIVENGLGAKDVPDENGYVTDDYRIDYMRKHIIDLKDAVEIDGVELMGYTSWG
CIDLISASTGQMSKRYGFIYVDRDDAGQGTLRRSKKKSFDWYKQVIASNGEEL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggttttatcagaaaattttttatggggcggtgctacggcagccaatcaagctgaaggt
ggtgtcttagaaggtggtcgtggcttgtcaaatgttgatttattacctattggaaaagac
agagccataatttctagtggtgaaatagaacatttagagtgggatgataatcatttttat
cctgccaaagaagctattgacatgtaccatcattataaagatgatattaaattatttgca
gagcttggtttcaaagtttatcgtatgtcaatttcgtggactcgtatttttccaaatgga
gatgatgagatgccaaatcaggcaggacttgatttctaccgtggtatttttgaagaattg
aaaaaatatggtattgaacctcttgtgactttggcacattttgatgtaccagtcagttta
attaaacgttatggtggttggcgtgaccgtcatttagtagatgcctatgtccgttatgcg
caaacggttatgacagcttacaaaggtttggtcaactattggttgacattcaatgaaatt
aatatcctgattcatagtccctttgtaggtggtgggcttatttttaaagaaggagataat
aagaaacaactcatgtatcaagcagctcatcatcaattagtcgcttcaagtttggtgact
aaagtggcacacgatattgattctgaaaatcaacttgggtgtatgttagcaggtggtatg
cattatccttactcttgtcgtccagaagattacaaggaagccattgatagtgatcgtaag
aattacttctttattgatgttcaagcgcgtggttattatccaaactatgcgaaaaaaatg
tttgaacgtgaacagattgagttggagatgttagatggtgatttagagtgtttgaaaaat
actgttgattttgtttctttctcttattattcatcacgtacagtaagtggttttgaggag
gattatgaaacaacaactggcaaccttttccgctcgataaaaaatcctaatttagaatca
acagaatggggctggcaaattgatccgttggggttacgtaatgccttaaatcagctttat
gaccgttatcaaaagccattattcattgtcgaaaatggtcttggtgctaaggacgtccct
gatgaaaatgggtatgtgacagatgattatcgtattgattatatgcgcaagcatattatt
gatttaaaagatgctgttgaaatcgatggtgttgagttaatgggctacaccagctggggc
tgtattgatttgatttcagccagtacaggtcaaatgagtaaacgttacggttttatctat
gttgaccgagatgacgcaggtcagggcactttacgtcgcagtaagaaaaaatcatttgac
tggtataaacaagtcattgcttcaaatggcgaagagctttaa

DBGET integrated database retrieval system