KEGG   Streptococcus gallolyticus UCN34: GALLO_0488Help
Entry
GALLO_0488        CDS       T01171                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GALLO_0488 (gmk)
Enzymes [BR:sga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     GALLO_0488 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
511433..512050
Genome map
AA seq 205 aa AA seqDB search
MTERGLLIVFSGPSGVGKGTVRQEIFSTPDHKFEYSVSMTTRQKRPGEVDGVDYFFRTRE
EFEELIKNGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDGVF
IFLTPPDLDELKDRLVGRGTDSEEVIRQRIERAKEEIALMREYDYAVVNDEVPLAAERVK
RIIEAEHFRVDRVIGRYNDMIKDID
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgtggtttgttaattgttttctcaggaccttctggggttggtaagggaaca
gttcgccaagaaattttttcaacaccagatcataaatttgaatattccgtttctatgaca
acacgccaaaaacggccaggagaagtcgatggcgttgattatttcttccgaactcgtgaa
gaatttgaggagcttattaaaaatggtcaaatgttggaatatgctgaatacgtaggaaac
tactatggcacaccactgacttatgttaatgaaactcttgataaggggattgatgtgttc
cttgaaatcgaagtgcaaggagcgcttcaagttaagaagaaagttccagatggggtgttt
attttcttaacgccacctgatttggacgaattaaaagatcgtttggtaggacgtggtaca
gatagcgaggaagttatccgccaacgtatcgaacgtgctaaagaagaaatcgctttgatg
cgtgagtatgattatgctgttgttaacgatgaagtgcctttggcagctgaacgcgttaaa
cgcattatcgaagcagaacatttccgtgttgatcgtgttatcggacgatataacgacatg
attaaagatattgattaa

DBGET integrated database retrieval system