KEGG   Streptococcus gallolyticus UCN34: GALLO_0588Help
Entry
GALLO_0588        CDS       T01171                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase (beta subunit)
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
sga00260  Glycine, serine and threonine metabolism
sga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sga01100  Metabolic pathways
sga01110  Biosynthesis of secondary metabolites
sga01130  Biosynthesis of antibiotics
sga01230  Biosynthesis of amino acids
Module
sga_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GALLO_0588 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GALLO_0588 (trpB)
Enzymes [BR:sga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GALLO_0588 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBI13080
Position
611448..612650
Genome map
AA seq 400 aa AA seqDB search
MSYNQPDTNGFYGKFGGQFVPETLMTAVIELDEAYREAKADPSFQEELDALLKNYVGRET
PLYYAERLTKHIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVANIEDTHYIMGSALGPAPFPEMVRDFQSVIGQEAKEQYAEISGGKLPDAVLACVGGGS
NAIGLFYPFVEDESVALYGAEAAGHGLDTEEHAATFAKGRIGILHGALMNVLQDRHGQIM
EAFSISAGLDYPGVGPEHCHFKDIGRATYDSITDDEALESFMLLSRLEGIIPALESSHAI
ALTQKVAKELGPDKSIIVCLSGRGDKDVVQVKERLEAEGK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagctataaccaaccagatactaatggattttacggaaaatttggtggacaatttgtt
cccgaaacgctgatgactgcggttatcgaacttgatgaagcttaccgcgaagctaaggca
gacccaagctttcaagaagaactcgatgcgcttttgaaaaattatgttggtcgtgaaaca
ccgctttattatgcagagcgtttaacaaaacatatcggcggtgcgaaaatttacctcaaa
cgtgaagaccttaaccacacaggtgctcataaaattaataatgccctcggtcaagttctc
cttgctaaacgaatgggcaaaaagaaaatcattgccgaaactggtgctggtcaacacggg
gttgcaacagcaacagcagctgcactttttgacatggaatgtacgatttacatgggtgaa
gaggacgtgaaacgccaagcactcaatgttttccgtatggaattgctaggcgctaaagtc
ttttctgtaactgatggttcacgcgttttgaaagatgccgtaaatgcagcccttcgcgcg
tgggtagctaatatcgaagatacacactatatcatggggtcagctctcggacctgcacct
ttccctgaaatggttcgtgacttccaatctgttatcggtcaagaagcaaaggaacaatat
gcagagatttcaggaggaaaactgcctgatgctgtcctagcctgtgttggcggtggttca
aatgcgattggtcttttctatccatttgtcgaagatgaatcagttgctctttacggtgct
gaagcagcaggacatggacttgatactgaagaacacgctgcaacatttgccaaaggacgt
ataggtattttgcatggtgctttgatgaatgttttgcaagaccgtcatggacaaatcatg
gaagctttctcaatctcagctggtcttgattatccaggcgttggtccagaacattgccat
ttcaaagacattggtcgtgcaacatacgattctattaccgatgatgaagcacttgaatcg
tttatgcttctatcacgtttggaagggattattccagccctcgaatcaagtcatgccatt
gctttgactcaaaaagtggctaaggaattaggaccagataaatcaatcattgtttgtcta
tctggacgtggtgataaggatgttgtgcaagtaaaagaacgtttggaagcagaagggaaa
tag

DBGET integrated database retrieval system