KEGG   Streptococcus gallolyticus UCN34: GALLO_0589Help
Entry
GALLO_0589        CDS       T01171                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GALLO_0589 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GALLO_0589 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GALLO_0589 (trpA)
Enzymes [BR:sga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GALLO_0589 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
612654..613436
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLENIAASGKGIFVPYIMAGDHEKALDGLFDTITFLENSGASAIEVGIPWSDP
VADGPVIELAGQRSLANGVNLTAIVQKLQEKQTTVPLVIMTYINPVYQYGIEKFIADLKN
TSVKGLIIPDLPHEHENMVKPYLTDTDIALVPLVSLTTGIERQKTLCKDAEGFIYAVAIN
GVTGKTGNYRDDLDKHLTNLKAIADIPVLTGFGVSTSADIERFNKVSDGVIVGTKIVRDL
HEGKTDDVADFVKYGSNYQK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacactcacaaaacatcttgaaaacattgcagcaagcggtaaaggaattttt
gtgccatacattatggcaggagaccacgaaaaagctttagacggtttgtttgacaccatt
acttttttggaaaatagcggagcttctgctattgaagtgggcattccatggtcagacccc
gttgctgacggaccagtcattgaattggcagggcaaagaagcttggctaacggtgtgaat
ttaacagcgattgttcaaaaattacaagaaaaacaaacgacagttcctttggtcatcatg
acttacatcaatcctgtctatcaatacggcattgagaaatttattgctgacttgaaaaat
acgtctgttaaagggttgattattcctgatttaccacacgaacacgaaaatatggtaaaa
ccatatcttaccgacacagatattgcgcttgtgccactcgttagtctgacaacaggtatt
gaacgtcaaaaaacgttatgtaaagatgctgaaggatttatctatgctgttgctattaac
ggtgttactggtaaaactggcaattatcgtgatgatttggataaacatttgaccaatctg
aaagccattgctgacattcctgttttaacaggttttggtgtctcaacttcagcggacatt
gagcgctttaacaaagtatcagacggtgttattgtcggaacaaaaattgttagagactta
cacgaaggaaaaacagatgatgttgctgacttcgtcaaatacggctcaaattatcaaaaa
taa

DBGET integrated database retrieval system