KEGG   Streptococcus gallolyticus UCN34: GALLO_0644Help
Entry
GALLO_0644        CDS       T01171                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GALLO_0644 (gpmA)
   01230 Biosynthesis of amino acids
    GALLO_0644 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GALLO_0644 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    GALLO_0644 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GALLO_0644 (gpmA)
Enzymes [BR:sga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GALLO_0644 (gpmA)
Exosome [BR:sga04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GALLO_0644 (gpmA)
  Exosomal proteins of melanoma cells
   GALLO_0644 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
667105..667797
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGQSEWNKANLFTGWADVDLSEEGTKQAIEAGKLIKEAGIEFDLAFTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGQNKAEAAEKWGDEQVHIWRRSYDVL
PPAMAKDDEYSAHTDRRYANLDDTVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNVTNEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattagtgtttgcacgccacggtcaatctgaatggaacaaagctaaccttttc
actggttgggctgatgttgacctttcagaagaaggtacaaaacaagctatcgaagctggt
aaattgattaaagaagcaggaatcgaatttgaccttgctttcacttcagttcttaaacgc
gctatcaaaacaactaaccttgctcttgaagctgctgaccaactttgggttccagttgaa
aaatcatggcgcttaaacgaacgtcactacggtggtttgactggtcaaaacaaagctgaa
gctgctgaaaaatggggtgacgaacaagttcacatctggcgtcgttcatacgatgtattg
ccaccagctatggctaaagatgacgaatattcagcacacactgaccgtcgttacgctaac
cttgacgacacagtaattccagatgctgaaaacttgaaagttactttggaacgcgctctt
ccattctgggaagataaaatcgctccagctcttaaagacggtaaaaacgtctttgtaggt
gcacacggtaactcaatccgcgctcttgtaaaacacatcaaacaattgtcagatgacgaa
attatggatgttgaaatccctaacttcccaccacttgtattcgaattcgacgaaaaatta
aacgttacaaacgaatactaccttggcaaataa

DBGET integrated database retrieval system