KEGG   Streptococcus gallolyticus UCN34: GALLO_0782Help
Entry
GALLO_0782        CDS       T01171                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GALLO_0782
Enzymes [BR:sga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GALLO_0782
Exosome [BR:sga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GALLO_0782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
823648..825549
Genome map
AA seq 633 aa AA seqDB search
MDTKEALRTFGTGENFHAQHYFGFHKETRNGTEGYSFRVWAPNAQSVHLIGDFTQWRENP
LAMERNEAGVWEIFTDLPKENQLYKYLVKRSTGQEVEKLDPFAIYFEKRPGTAAVLTDFP
EKKWKDALWLGRRKRFGFRNRPVNIYEVHAGSWKQHDDGRPYQFKELTEELIPYLVKMNY
THVEFMPLMAHPLGMSWGYQLMGYFAFEHSYGTPEDFQNFVETCHLNNIGVIVDWVPGHF
TINDDALAYFDGTPTFEYEDEDRAHNRGWGALNFDLGKNQVQSFLISSAKFWIDYYHLDG
IRVDAVSNMLYRDYDIGPWTPNKDGGNRNYEGYYFLQKLNAVLKSFYPDIMMIAEESTSD
TKITGPIEYDALGFDYKWNMGWMNDILKFYEEDPIYRKYDFNLVTFSFMYAFSENFILPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEFGQFLEWKYDYQ
LEWVNLEDDLNKKMQDFTSQLNAFYKEHNVLWQIDDSYDGIEIIDADNTDQTVLSFIRKN
KDGDMLICVFNMVPVERKDFTIGVPVAGIYEEVWNTEMEEFGGVWKEHNLQARTQDRLWK
NYHHTLSFTLPALGASIWKIKRRLAKQIPKKGK
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggacacgaaagaggcactgagaacttttggaacgggtgaaaattttcatgcgcaacat
tactttggctttcataaagaaactcgtaatggtaccgaaggttacagttttagagtctgg
gcacccaacgctcaatctgttcatctgattggtgatttcactcaatggagagaaaatccg
cttgctatggaacgcaacgaagcaggtgtatgggaaatttttacggatttacctaaagaa
aatcaactttacaagtatcttgtaaaacgttcgactggtcaagaagttgaaaaattagac
ccatttgctatttatttcgaaaagcgaccagggacagcagcagttcttacagattttcca
gaaaagaagtggaaagatgcactttggttagggcgacgcaaacgtttcggtttccgtaat
cgtcctgttaatatctatgaagtgcatgcaggttcatggaaacaacatgatgatggtcgt
ccttatcaatttaaggaattaacagaagaattgattccttatttggttaagatgaattac
acgcacgttgaattcatgccgttaatggcacatccgcttgggatgagttggggttatcaa
ctaatggggtactttgctttcgagcatagttatggaacgccagaggatttccaaaatttc
gttgaaacttgtcatttgaataatatcggtgtcattgtggattgggttccaggacatttt
acgattaatgatgatgctttggcttattttgatggaacgccaacgtttgagtacgaggat
gaagaccgagctcataaccgtggttggggcgctctaaattttgaccttggaaaaaatcaa
gttcagtctttcttaatttctagtgccaagttttggatagattattatcacttagatggt
attcgagtggatgccgtaagtaacatgctgtatcgtgactatgatattggaccttggaca
ccaaataaagatggtggtaaccgtaattatgaggggtattatttcttacaaaaactaaat
gccgttttgaaaagcttttatcctgatatcatgatgattgctgaagaaagtaccagtgac
actaaaattacaggtcctattgaatacgatgcactcggctttgattataaatggaatatg
ggatggatgaatgatattttgaaattctatgaagaagatcccatttatcgtaagtatgat
tttaatcttgtcacatttagttttatgtatgctttttctgaaaactttatcctaccattc
tcacacgatgaagtggttcacggaaagaaaagcttgatgcataaaatgtggggtgaccgt
tacaatcaatttgctgggcttcgtaatctttatacctatcaaatctgtcatccaggcaaa
aaattgctctttatgggaagtgaatttggtcaatttcttgaatggaaatatgactatcag
ctagaatgggttaatttggaagatgacttaaacaagaaaatgcaagatttcacaagtcaa
ctgaatgcattctacaaagagcacaatgtcttgtggcaaatagatgatagctatgacggt
atcgaaatcattgatgcagacaatactgaccagaccgttctatccttcattcgtaaaaac
aaagatggcgatatgttaatttgtgtgtttaacatggtgcccgttgaacgtaaagacttt
acaattggagttccagttgcaggcatttacgaagaagtttggaatacagaaatggaagaa
tttggtggtgtctggaaagaacataatctccaagctcgcacacaagatagactttggaag
aattaccatcatacgttaagtttcaccttacctgcactcggtgccagtatatggaaaata
aaacgacgtttggcaaaacagattcctaagaaaggaaaatag

DBGET integrated database retrieval system