KEGG   Streptococcus gallolyticus UCN34: GALLO_0796Help
Entry
GALLO_0796        CDS       T01171                                 

Gene name
murAA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sga00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sga00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
838653..839927
Genome map
AA seq 424 aa AA seqDB search
MDKIIIEGGNTRLQGEVVIEGAKNAVLPLLAATILPEEGKTILTNVPILSDVFTMNNVVR
GLNIQVDFDEANNKIEVDASGDILDIAPYEYVSKMRASIVVLGPILARNGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGAKITQSGGDITATVDGKLKGTTIYMDFPSVGATQNLMMAATL
ADGVTIIENVAREPEIVDLAMLLNKMGANVRGAGTETLTITGVDSLHGAEHDVVQDRIEA
GTFMVAAAMTSGNVLIKDAIWEHNRPLISKLIEMGVTVVDEEDGIRVIADTSTLRPVTVK
TLPHPGFPTDMQAQFTALMAVVDGESTMIETVFENRFQHLEEMRRMGLQSEILRDTAMIH
GGKELQGAPVMSTDLRASAAMILTGMVAKGTTTVGKLVHLDRGYYKFHEKLAKLGANIKR
VSEA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
ttggataaaattattattgaaggtggtaatacacgtttgcaaggagaagtagtgattgaa
ggagctaaaaatgctgttcttccactcttggctgcaacaattttacctgaggaaggaaag
acaattttaaccaatgttccaatcctttcagatgtttttacgatgaataatgttgtccgt
gggttgaatattcaagttgattttgatgaagctaacaataaaatcgaagtggatgcttct
ggtgatattttggatattgctccttacgagtatgttagtaagatgcgtgcttcaatcgtt
gttttaggaccaattttagcacgtaatggacacgccaaggtttcaatgcctggtggttgt
acgattggtagccgcccaattgaccttcaccttaaaggtttggaggcaatgggagctaag
attacgcaatctggtggtgatattacggcaactgttgatggtaagctcaaagggacaact
atctacatggatttcccgtctgttggggcaacgcaaaacttgatgatggcagcgacttta
gcagatggtgttacgattattgaaaatgtggcacgtgagccagaaatcgttgatttggca
atgctactcaataaaatgggggctaatgttagaggtgctggtacagaaactttgactatc
actggtgttgatagccttcatggggcagaacatgatgtggttcaagaccgtattgaggct
ggtacttttatggtggcagcagccatgacatcaggaaatgttcttatcaaagatgctatc
tgggaacataaccgtccattgatttcaaaattgattgaaatgggggttactgttgttgat
gaggaagatggtattcgtgtgattgctgatacgtcaacattgcgacctgtaacggttaaa
acacttccacatcctggttttccaacagatatgcaagcacagtttacagccttgatggca
gtcgtagatggcgaatcaacgatgattgaaactgtttttgagaatcgtttccaacatttg
gaagaaatgcgccgtatgggcttgcaatcggaaattttgcgagatacggctatgattcac
ggtggtaaagaactccaaggagcacctgtgatgtcaacggaccttcgtgcgagtgcagct
atgattttgacaggaatggttgctaaaggaacaacgactgtcggaaaattggttcacctt
gaccgtgggtattataaattccatgaaaaattggctaaactcggtgcaaatattaaacgc
gtaagtgaggcttaa

DBGET integrated database retrieval system