KEGG   Streptococcus gallolyticus UCN34: GALLO_0869Help
Entry
GALLO_0869        CDS       T01171                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase, dihydrolipoamide acetyltransferase E2 subunit
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GALLO_0869
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GALLO_0869
   00020 Citrate cycle (TCA cycle)
    GALLO_0869
   00620 Pyruvate metabolism
    GALLO_0869
Enzymes [BR:sga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GALLO_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918770..920164
Genome map
AA seq 464 aa AA seqDB search
MANEIIMPKLGVDMQEGEILEWKKAEGDEVNEGDILLEIMSDKTNMEIEAEDSGVLLKIV
HPAGDVVAVTEIIGYIGAEGETLVDSVGEKHVEQSASAQEAKAQPLQASTAPAISQKTSE
TGKVRATPAARKLARERGIDLEKITGSGENGRIHKEDVEQFSKIRVTPLARRIAKDKGVD
LETLVGTGVSGKITKEDVLASLGDVAPQKEQADVKVTPQAGALADVTAASDGVEVIKMSA
MRKAISKGMSHSYFTAPTFTLNYDIDMTNLIALRKQLIEPIMAKTGYKVTFTDLIGLAVI
KTLMKEEHRFLNASLINDAQDIELHHFVNLAIAVGLSEGLVVPVVHGADQMSLSDFVVAS
KDVIQKAQAGKLKAAEMSGSTFTITNLGMFGVKSFNPIINQPNSAILGISATIETPVVHD
GEVVIRPIMGMSLTIDHRLVDGMNGAKFMLDLKALLENPLELLI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgaaattattatgccaaagcttggtgtggacatgcaagaaggggaaattctt
gaatggaaaaaagctgaaggtgatgaggtcaatgagggtgatattctgcttgaaatcatg
tctgataagaccaatatggaaatcgaagctgaagattctggcgtgctgttgaaaatcgtt
catccggcaggtgatgtcgtagctgttaccgaaattatcggctatatcggagcagaaggt
gaaactcttgttgattctgtgggtgagaaacatgttgaacagtcagcatcagctcaggaa
gcgaaagctcaaccgttgcaagcaagcacagcgccagcgatttcccaaaagacgtctgaa
actggaaaagtccgtgctacgcctgctgctagaaagttagcacgtgagcgtggtattgac
cttgaaaaaatcactggcagcggtgaaaatgggcggattcacaaggaagatgtggaacaa
tttagtaagattcgtgtgacgccactggctcgtaggattgcaaaggacaaaggtgttgac
cttgagacactggtgggaacgggtgtttctggtaagattaccaaggaagatgttttagca
agtctaggtgatgttgcgccgcaaaaagaacaagcagatgtaaaagtgacaccgcaagca
ggagctttggctgatgttacggctgcaagtgacggcgttgaagtcattaagatgtctgct
atgcgtaaggcaatttcaaagggaatgagccattcttactttacagcaccgacctttacg
cttaattatgatattgatatgacgaatctgattgccttgcgtaagcaactcattgagcca
attatggcaaagactggttacaaggtgacctttacggacttaattgggcttgctgtgatt
aagaccttgatgaaggaggaacaccgtttccttaatgcttctctgattaacgacgctcaa
gacatcgaactacatcattttgtcaatcttgcaatcgctgttgggctttctgaaggttta
gtggttcctgtggttcatggtgcagaccagatgagtttgtcagactttgtggtagcatca
aaagatgtgattcaaaaagcacaagctggtaaattgaaagcggctgaaatgtctggctca
acattcaccataacgaaccttgggatgtttggagtgaagtcgtttaatccgattattaat
caaccaaattcggcaattcttgggatttcagcaactattgaaacacccgtcgttcatgac
ggtgaagtggttattcgcccaattatggggatgagtttgaccattgatcaccgattggtt
gacggaatgaatggtgcaaaattcatgctagatttaaaagcgcttcttgaaaatccgcta
gaattgctaatctaa

DBGET integrated database retrieval system