KEGG   Streptococcus gallolyticus UCN34: GALLO_0989Help
Entry
GALLO_0989        CDS       T01171                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase (PFK)
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
sga00010  Glycolysis / Gluconeogenesis
sga00030  Pentose phosphate pathway
sga00051  Fructose and mannose metabolism
sga00052  Galactose metabolism
sga00680  Methane metabolism
sga01100  Metabolic pathways
sga01110  Biosynthesis of secondary metabolites
sga01120  Microbial metabolism in diverse environments
sga01130  Biosynthesis of antibiotics
sga01200  Carbon metabolism
sga01230  Biosynthesis of amino acids
sga03018  RNA degradation
Module
sga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GALLO_0989 (pfkA)
   00030 Pentose phosphate pathway
    GALLO_0989 (pfkA)
   00051 Fructose and mannose metabolism
    GALLO_0989 (pfkA)
   00052 Galactose metabolism
    GALLO_0989 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    GALLO_0989 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GALLO_0989 (pfkA)
Enzymes [BR:sga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GALLO_0989 (pfkA)
Protein phosphatases and associated proteins [BR:sga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GALLO_0989 (pfkA)
Messenger RNA biogenesis [BR:sga03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GALLO_0989 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Radical_SAM
Motif
Other DBs
NCBI-ProteinID: CBI13481
Position
1042399..1043415
Genome map
AA seq 338 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAIKEGMEVFGINRGYAGMVEGDIFPLDAQSVSNT
LSHGGTFLQSARYPEFATLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAMEALDKIRDTSFSHKRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEEYDIKDVVAKVKDGYENKGKERHLIVLAEGVMHAEKFAELMKEAGD
TSDLRATNLGHILRGGAPSPRDRVLASWMGAHAVELLLEGRGGLAVGIHNEELVESPILG
TKEEGALFSLAEDGSIIVNMPHKARLDFAKLNRDIAHL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggcggcgacgctcctggtatgaatgctgctgtt
cgtgcagttgttcgtaaagcaattaaagaaggaatggaagttttcggaatcaaccgtggc
tatgctggtatggttgaaggcgatatcttcccattggatgctcaaagtgtgtcaaatact
ttgtcacatggtggtacattccttcaatctgctcgttatcctgagtttgcaactcttgaa
ggacaattagcaggtatcgaacaacttaaaaaacacggtattgaaggtgtcgttgttatc
ggtggtgatggttcttatcatggtgctatgcgcttgactgaacatggtttcccagctgtc
ggtattccaggtacaattgataacgatatcgctggtacagattatactattgggtttgat
acagctgttaacacagctatggaagctcttgataaaatccgtgatacatcattcagtcac
aaacgtactttcgttgtcgaagtaatgggacgtaatgctggtgatatcgctctttggtct
ggtattgctgcaggtgctgaccaaatcatcatccctgaagaagaatacgacatcaaagac
gttgttgcaaaagttaaagatggttatgaaaacaaaggtaaagaacgtcaccttatcgtt
cttgctgaaggtgttatgcatgccgaaaaatttgctgaattgatgaaagaagctggagat
actagcgaccttcgtgctacaaaccttggtcacatccttcgtggtggtgctccatcacct
cgtgatcgtgttcttgcttcttggatgggtgcacacgccgttgaacttcttcttgaagga
cgtggtggacttgctgttggtatccacaacgaagaattggtagaaagcccaatccttgga
acaaaagaagaaggtgcattgttctcattggcagaagatggaagcattattgttaacatg
cctcacaaagcacgccttgactttgctaaattaaaccgtgacattgctcacttatag

DBGET integrated database retrieval system