KEGG   Streptococcus gallolyticus UCN34: GALLO_0989Help
Entry
GALLO_0989        CDS       T01171                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sga01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sga01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sga00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sga00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sga00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sga00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:sga00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1042399..1043415
Genome map
AA seq 338 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAIKEGMEVFGINRGYAGMVEGDIFPLDAQSVSNT
LSHGGTFLQSARYPEFATLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAMEALDKIRDTSFSHKRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEEYDIKDVVAKVKDGYENKGKERHLIVLAEGVMHAEKFAELMKEAGD
TSDLRATNLGHILRGGAPSPRDRVLASWMGAHAVELLLEGRGGLAVGIHNEELVESPILG
TKEEGALFSLAEDGSIIVNMPHKARLDFAKLNRDIAHL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggcggcgacgctcctggtatgaatgctgctgtt
cgtgcagttgttcgtaaagcaattaaagaaggaatggaagttttcggaatcaaccgtggc
tatgctggtatggttgaaggcgatatcttcccattggatgctcaaagtgtgtcaaatact
ttgtcacatggtggtacattccttcaatctgctcgttatcctgagtttgcaactcttgaa
ggacaattagcaggtatcgaacaacttaaaaaacacggtattgaaggtgtcgttgttatc
ggtggtgatggttcttatcatggtgctatgcgcttgactgaacatggtttcccagctgtc
ggtattccaggtacaattgataacgatatcgctggtacagattatactattgggtttgat
acagctgttaacacagctatggaagctcttgataaaatccgtgatacatcattcagtcac
aaacgtactttcgttgtcgaagtaatgggacgtaatgctggtgatatcgctctttggtct
ggtattgctgcaggtgctgaccaaatcatcatccctgaagaagaatacgacatcaaagac
gttgttgcaaaagttaaagatggttatgaaaacaaaggtaaagaacgtcaccttatcgtt
cttgctgaaggtgttatgcatgccgaaaaatttgctgaattgatgaaagaagctggagat
actagcgaccttcgtgctacaaaccttggtcacatccttcgtggtggtgctccatcacct
cgtgatcgtgttcttgcttcttggatgggtgcacacgccgttgaacttcttcttgaagga
cgtggtggacttgctgttggtatccacaacgaagaattggtagaaagcccaatccttgga
acaaaagaagaaggtgcattgttctcattggcagaagatggaagcattattgttaacatg
cctcacaaagcacgccttgactttgctaaattaaaccgtgacattgctcacttatag

DBGET integrated database retrieval system