KEGG   Streptococcus gallolyticus UCN34: GALLO_0989Help
Entry
GALLO_0989        CDS       T01171                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GALLO_0989 (pfkA)
   01230 Biosynthesis of amino acids
    GALLO_0989 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GALLO_0989 (pfkA)
   00030 Pentose phosphate pathway
    GALLO_0989 (pfkA)
   00051 Fructose and mannose metabolism
    GALLO_0989 (pfkA)
   00052 Galactose metabolism
    GALLO_0989 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    GALLO_0989 (pfkA)
Enzymes [BR:sga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GALLO_0989 (pfkA)
Protein phosphatases and associated proteins [BR:sga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GALLO_0989 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1042399..1043415
Genome map
AA seq 338 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAIKEGMEVFGINRGYAGMVEGDIFPLDAQSVSNT
LSHGGTFLQSARYPEFATLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAMEALDKIRDTSFSHKRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEEYDIKDVVAKVKDGYENKGKERHLIVLAEGVMHAEKFAELMKEAGD
TSDLRATNLGHILRGGAPSPRDRVLASWMGAHAVELLLEGRGGLAVGIHNEELVESPILG
TKEEGALFSLAEDGSIIVNMPHKARLDFAKLNRDIAHL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggcggcgacgctcctggtatgaatgctgctgtt
cgtgcagttgttcgtaaagcaattaaagaaggaatggaagttttcggaatcaaccgtggc
tatgctggtatggttgaaggcgatatcttcccattggatgctcaaagtgtgtcaaatact
ttgtcacatggtggtacattccttcaatctgctcgttatcctgagtttgcaactcttgaa
ggacaattagcaggtatcgaacaacttaaaaaacacggtattgaaggtgtcgttgttatc
ggtggtgatggttcttatcatggtgctatgcgcttgactgaacatggtttcccagctgtc
ggtattccaggtacaattgataacgatatcgctggtacagattatactattgggtttgat
acagctgttaacacagctatggaagctcttgataaaatccgtgatacatcattcagtcac
aaacgtactttcgttgtcgaagtaatgggacgtaatgctggtgatatcgctctttggtct
ggtattgctgcaggtgctgaccaaatcatcatccctgaagaagaatacgacatcaaagac
gttgttgcaaaagttaaagatggttatgaaaacaaaggtaaagaacgtcaccttatcgtt
cttgctgaaggtgttatgcatgccgaaaaatttgctgaattgatgaaagaagctggagat
actagcgaccttcgtgctacaaaccttggtcacatccttcgtggtggtgctccatcacct
cgtgatcgtgttcttgcttcttggatgggtgcacacgccgttgaacttcttcttgaagga
cgtggtggacttgctgttggtatccacaacgaagaattggtagaaagcccaatccttgga
acaaaagaagaaggtgcattgttctcattggcagaagatggaagcattattgttaacatg
cctcacaaagcacgccttgactttgctaaattaaaccgtgacattgctcacttatag

DBGET integrated database retrieval system