KEGG   Streptococcus gallolyticus UCN34: GALLO_1003Help
Entry
GALLO_1003        CDS       T01171                                 

Definition
glycoside hydrolase (beta-glucosidase)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sga00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1059934..1061397
Genome map
AA seq 487 aa AA seqDB search
MTKQFPEGFLWGGATAANQFEGAWNVDGRGPATSDTARAVAPEERKSMGSEFNSPMTRAK
LDAALNDKEGLYPKRWGSDFYHRYKEDIALYAEMGFKTFRLSIAWSRIFPNGDDATPNEA
GLAFYDKVFDELNKYGIEPLVTLSHYEFPIHLVTEYGGWKNRKVIDFFVRYAETVFNRYK
DKVKYWLTFNEINIIGMTGYLSGGLLFEDGKLNLQDMYQAAHHQFVASSLATKIGHEINP
DFKIGCMLARMQAYPATCNPEDVMEEIKKDHENLFFSDVQVRGKYPAYAKRFFKENNIEL
EIADGDLEILEKYPVDFMSFSYYMSSIARKQKTGDQTAGNLILSEPNPYLEASDWGWQID
PVGLRITLNNLYDRYQVPLMVVENGLGALDTVEEDGSIHDQYRIDYLQSHVKQMYEAIED
GVDLMGYTWWGCTDLVSASTSEMSKRYGFVYVDADDQGNGSFDRSRKDSFFFYKDLIATR
GANILND
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaatttccagaaggatttttgtggggcggtgcaacagctgccaatcaattt
gaaggcgcttggaatgttgacggacgtggtccagcaacatcggatacagcgcgtgccgtt
gctccagaagaacgcaaatcaatgggaagtgaatttaattcaccaatgactcgtgctaaa
ttggatgcagctttgaatgataaagaagggctttatccaaaacgttgggggtctgatttt
tatcatcgttataaagaagatattgccctttatgccgaaatgggcttcaagacttttcgt
ctttctattgcatggtcacgtatttttccaaatggtgatgatgcgacaccgaatgaagct
gggttagctttttatgataaggtttttgatgagcttaataaatacggcatcgagccactg
gttactttatctcactatgaatttccaatccacttggtaacggaatacggtggctggaaa
aatcgtaaagtgattgatttctttgttcgttatgctgaaacggtctttaatcgttacaaa
gataaggtcaaatattggttgacattcaatgaaattaatattattggtatgactggttat
ttatcaggtgggctcttgtttgaagatggtaaattgaacctccaagatatgtatcaagca
gctcatcatcagtttgtagcatcaagtttggcaacaaaaatcggtcacgagattaatcct
gatttcaagattgggtgtatgttagcgcgtatgcaagcctatcctgcgacctgcaatcca
gaagacgtcatggaagaaatcaaaaaagaccatgaaaatctattcttctctgatgttcaa
gttcgcggaaaatacccagcatatgccaaacgtttctttaaagaaaataatatcgaatta
gaaatcgcagacggtgaccttgaaattcttgaaaaatatcctgttgacttcatgtcattc
tcatattatatgagttcaattgctcgtaagcaaaaaacgggcgaccaaacagcaggaaat
cttatcctaagcgaaccaaatccatatcttgaagcttctgactggggttggcaaatcgat
cctgtcggacttcgtatcacgcttaacaatctttatgaccgttaccaagtaccgcttatg
gttgttgaaaatggtctaggtgctcttgatacagtagaagaagacggttcgattcacgac
caataccgtattgattatctccaatcacacgtcaaacaaatgtatgaagccattgaggac
ggcgttgatttgatgggatacacttggtggggttgtacagaccttgtttcggcgtcaact
tctgaaatgtcaaaacgctatggttttgtttacgttgatgctgacgaccaaggaaacggt
agctttgaccgctcacgtaaagactcattcttcttttataaagatttgattgcaacacgt
ggcgctaatattttaaacgattaa

DBGET integrated database retrieval system