KEGG   Streptococcus gallolyticus UCN34: GALLO_1470Help
Entry
GALLO_1470        CDS       T01171                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
sga00340  Histidine metabolism
sga01100  Metabolic pathways
sga01110  Biosynthesis of secondary metabolites
sga01230  Biosynthesis of amino acids
Module
sga_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    GALLO_1470 (hisD)
Enzymes [BR:sga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     GALLO_1470 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Imm21
Motif
Other DBs
NCBI-ProteinID: CBI13961
Position
complement(1548389..1549666)
Genome map
AA seq 425 aa AA seqDB search
MKRLTGTTEEISKILYQEQLELSKENLDVDDAVRQILEDVKENGDKALKAYSEKFDKITL
DNFEVGKELVDQAFEEIDAEVLEALKNAKANIESYHKQQLEKGFEDQPTEGVVRGQLIRP
IERVGVYVPGGTAAYPSSVLMNVIPAKIAGVKEIIMITPPQAHFEPAILVAASLAGVDKI
YQVGGAQGIAALAYGTETIPRVDKITGPGNIFVATAKKLVYGIVGIDMIAGPSEIGVIAD
DTANPKYVAADLLSQAEHDVRARAILVTNSAALADAVEKEIEEQLKTLPREEIARASVEN
NGRIIIADSVEAMFELMNQVAPEHLEIAMDNAYDYLDAIENAGSVFLGHFTSEPIGDYYA
GANHILPTTSTSRFSSALGVHDFVKRIQYMQYSKIAVNVASHDITTLAYAEGLQAHARAI
EVRHD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttaacaggaacgacagaagaaatttcaaaaattctctaccaagaacaatta
gaattaagcaaagaaaatcttgatgttgatgatgcggttcgtcaaattttagaagatgtc
aaagaaaatggtgataaagcacttaaagcctattcagaaaaatttgacaagattacgctt
gataattttgaagttggcaaggagttggttgaccaagcgtttgaggaaattgatgccgag
gttttggaagctctcaaaaatgccaaagcgaatattgaaagttatcacaagcaacagttg
gaaaaaggatttgaggaccaaccaactgaaggcgttgttcgtgggcaattgattcgtccg
attgagcgtgttggggtttatgtcccaggtggaactgctgcttatccgtcatctgttttg
atgaatgtcattccagctaagattgctggtgttaaagaaattatcatgattacaccgcca
caagcgcatttcgaacctgcgattttggtggctgcttcgttagctggtgttgataagatt
tatcaagttggcggggctcaaggtatcgctgctttggcatatggtacagaaacgattcct
cgtgttgataagattactggaccaggaaatatttttgttgcgacagctaaaaaactcgtt
tacggtattgttggtattgatatgattgcaggtccgtctgaaattggtgtgatcgcagat
gacacagccaatccaaaatacgttgcagcagatttgctctcacaagctgagcatgatgtg
cgtgcgcgtgcgattttggtgacaaattcagcagcgttagcggatgcggttgaaaaggaa
atcgaagaacaacttaaaaccttgccacgtgaagaaattgcgcgtgcttctgttgaaaat
aatggtcgtatcatcattgcagattctgttgaggcaatgtttgaattgatgaaccaagtg
gcgccagaacatttggaaattgctatggataatgcttatgattatcttgatgcgattgaa
aatgcgggttctgttttccttgggcattttacgagtgaaccaatcggtgattattacgca
ggggcaaatcatattttgccaacaactagcacaagccgtttctcatcagcgctaggtgtg
catgattttgtcaaacgtatccagtatatgcaatattcaaaaattgctgtgaatgtagct
agtcacgatattacaacacttgcttatgctgaaggattacaagctcatgctagagctatt
gaggtgcgtcatgactaa

DBGET integrated database retrieval system