KEGG   Streptococcus gallolyticus UCN34: GALLO_1470Help
Entry
GALLO_1470        CDS       T01171                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sga01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:sga00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1548389..1549666)
Genome map
AA seq 425 aa AA seqDB search
MKRLTGTTEEISKILYQEQLELSKENLDVDDAVRQILEDVKENGDKALKAYSEKFDKITL
DNFEVGKELVDQAFEEIDAEVLEALKNAKANIESYHKQQLEKGFEDQPTEGVVRGQLIRP
IERVGVYVPGGTAAYPSSVLMNVIPAKIAGVKEIIMITPPQAHFEPAILVAASLAGVDKI
YQVGGAQGIAALAYGTETIPRVDKITGPGNIFVATAKKLVYGIVGIDMIAGPSEIGVIAD
DTANPKYVAADLLSQAEHDVRARAILVTNSAALADAVEKEIEEQLKTLPREEIARASVEN
NGRIIIADSVEAMFELMNQVAPEHLEIAMDNAYDYLDAIENAGSVFLGHFTSEPIGDYYA
GANHILPTTSTSRFSSALGVHDFVKRIQYMQYSKIAVNVASHDITTLAYAEGLQAHARAI
EVRHD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttaacaggaacgacagaagaaatttcaaaaattctctaccaagaacaatta
gaattaagcaaagaaaatcttgatgttgatgatgcggttcgtcaaattttagaagatgtc
aaagaaaatggtgataaagcacttaaagcctattcagaaaaatttgacaagattacgctt
gataattttgaagttggcaaggagttggttgaccaagcgtttgaggaaattgatgccgag
gttttggaagctctcaaaaatgccaaagcgaatattgaaagttatcacaagcaacagttg
gaaaaaggatttgaggaccaaccaactgaaggcgttgttcgtgggcaattgattcgtccg
attgagcgtgttggggtttatgtcccaggtggaactgctgcttatccgtcatctgttttg
atgaatgtcattccagctaagattgctggtgttaaagaaattatcatgattacaccgcca
caagcgcatttcgaacctgcgattttggtggctgcttcgttagctggtgttgataagatt
tatcaagttggcggggctcaaggtatcgctgctttggcatatggtacagaaacgattcct
cgtgttgataagattactggaccaggaaatatttttgttgcgacagctaaaaaactcgtt
tacggtattgttggtattgatatgattgcaggtccgtctgaaattggtgtgatcgcagat
gacacagccaatccaaaatacgttgcagcagatttgctctcacaagctgagcatgatgtg
cgtgcgcgtgcgattttggtgacaaattcagcagcgttagcggatgcggttgaaaaggaa
atcgaagaacaacttaaaaccttgccacgtgaagaaattgcgcgtgcttctgttgaaaat
aatggtcgtatcatcattgcagattctgttgaggcaatgtttgaattgatgaaccaagtg
gcgccagaacatttggaaattgctatggataatgcttatgattatcttgatgcgattgaa
aatgcgggttctgttttccttgggcattttacgagtgaaccaatcggtgattattacgca
ggggcaaatcatattttgccaacaactagcacaagccgtttctcatcagcgctaggtgtg
catgattttgtcaaacgtatccagtatatgcaatattcaaaaattgctgtgaatgtagct
agtcacgatattacaacacttgcttatgctgaaggattacaagctcatgctagagctatt
gaggtgcgtcatgactaa

DBGET integrated database retrieval system