KEGG   Streptococcus gallolyticus UCN34: GALLO_1510Help
Entry
GALLO_1510        CDS       T01171                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GALLO_1510 (tpi)
   01230 Biosynthesis of amino acids
    GALLO_1510 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GALLO_1510 (tpi)
   00051 Fructose and mannose metabolism
    GALLO_1510 (tpi)
   00562 Inositol phosphate metabolism
    GALLO_1510 (tpi)
Enzymes [BR:sga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GALLO_1510 (tpi)
Exosome [BR:sga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GALLO_1510 (tpi)
  Exosomal proteins of bladder cancer cells
   GALLO_1510 (tpi)
  Exosomal proteins of melanoma cells
   GALLO_1510 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1591262..1592020)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSELVEAGIAAPALDLSTVLAAAKGSNL
KVAAENCYFENAGAFTGENSPKVLSEMGTDYVVIGHSERREYFHETDEDINKKAKAIFAN
GMLPIICCGETLETYEAGKAAEFVGGQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDTVAADFGQAVADKVRVQYGGSVKPENVAAYMACPDVDGALVGGASLQ
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagtagcttctaaattgccttcatcagaacttgttgaagctggt
atcgcagctcctgcacttgacctttcaacagttcttgctgcagctaaaggttcaaacctt
aaagttgctgctgaaaactgctactttgaaaacgctggtgctttcactggtgaaaacagc
cctaaagtattgtctgaaatgggaactgactacgttgtaatcggtcactcagaacgtcgt
gaatacttccacgaaactgacgaagatatcaacaaaaaagctaaagcaatctttgctaac
ggtatgcttccaatcatctgctgtggtgaaactcttgaaacttacgaagctggtaaagca
gctgaattcgtaggtggacaagtttcagctgctcttgctggattgtcagaagaacaagtt
tcttcacttgttattgcatacgaaccaatctgggctatcggtactggtaaatcagctagc
caagatgacgcacaaaaaatgtgtaaagttgttcgtgacacagttgcagcagacttcggt
caagcagtagctgacaaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagcttacatggcttgcccagacgttgatggtgcccttgttggtggtgcatcacttcaa
ccagaaagcttccttgctcttcttgactttgtaaaataa

DBGET integrated database retrieval system