KEGG   Streptococcus gallolyticus UCN34: GALLO_1510Help
Entry
GALLO_1510        CDS       T01171                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
sga00010  Glycolysis / Gluconeogenesis
sga00051  Fructose and mannose metabolism
sga00562  Inositol phosphate metabolism
sga01100  Metabolic pathways
sga01110  Biosynthesis of secondary metabolites
sga01120  Microbial metabolism in diverse environments
sga01130  Biosynthesis of antibiotics
sga01200  Carbon metabolism
sga01230  Biosynthesis of amino acids
Module
sga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sga_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GALLO_1510 (tpi)
   00051 Fructose and mannose metabolism
    GALLO_1510 (tpi)
   00562 Inositol phosphate metabolism
    GALLO_1510 (tpi)
Enzymes [BR:sga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GALLO_1510 (tpi)
Exosome [BR:sga04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GALLO_1510 (tpi)
  Exosomal proteins of bladder cancer cells
   GALLO_1510 (tpi)
  Exosomal proteins of melanoma cells
   GALLO_1510 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBI14001
Position
complement(1591262..1592020)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSELVEAGIAAPALDLSTVLAAAKGSNL
KVAAENCYFENAGAFTGENSPKVLSEMGTDYVVIGHSERREYFHETDEDINKKAKAIFAN
GMLPIICCGETLETYEAGKAAEFVGGQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDTVAADFGQAVADKVRVQYGGSVKPENVAAYMACPDVDGALVGGASLQ
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagtagcttctaaattgccttcatcagaacttgttgaagctggt
atcgcagctcctgcacttgacctttcaacagttcttgctgcagctaaaggttcaaacctt
aaagttgctgctgaaaactgctactttgaaaacgctggtgctttcactggtgaaaacagc
cctaaagtattgtctgaaatgggaactgactacgttgtaatcggtcactcagaacgtcgt
gaatacttccacgaaactgacgaagatatcaacaaaaaagctaaagcaatctttgctaac
ggtatgcttccaatcatctgctgtggtgaaactcttgaaacttacgaagctggtaaagca
gctgaattcgtaggtggacaagtttcagctgctcttgctggattgtcagaagaacaagtt
tcttcacttgttattgcatacgaaccaatctgggctatcggtactggtaaatcagctagc
caagatgacgcacaaaaaatgtgtaaagttgttcgtgacacagttgcagcagacttcggt
caagcagtagctgacaaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagcttacatggcttgcccagacgttgatggtgcccttgttggtggtgcatcacttcaa
ccagaaagcttccttgctcttcttgactttgtaaaataa

DBGET integrated database retrieval system