KEGG   Streptococcus gallolyticus UCN34: GALLO_1517Help
Entry
GALLO_1517        CDS       T01171                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GALLO_1517
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GALLO_1517
Enzymes [BR:sga01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GALLO_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1601402..1601887
Genome map
AA seq 161 aa AA seqDB search
MTNLYDFTVKAQDGSDVQLSKYQGKILLIVNTATGCGLTPQYEGLQKLYDTYHDKGFEIL
DFPCNQFLNQAPGNADEINTFCTLNYQTTFPRFAKIKVNGKEADPLYDWLKSEQKGPLGK
RIEWNFAKFLIDQNGNVIKRFSSKTEPETIVTEIESLINDK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactaatctttatgactttactgtcaaagcccaagacggctctgatgtccaattgtca
aaataccaaggcaaaatcctactcattgtcaatacggcaacaggttgtggcttaacccca
caatacgaaggactacaaaaactttatgacacttaccatgacaaaggatttgaaatttta
gattttccttgtaatcaatttttaaatcaagcgccaggaaacgccgacgaaatcaatacc
ttttgcaccttgaattaccagacaacttttcctcgctttgcgaaaattaaagtcaacggt
aaagaagccgacccactctatgattggctaaaaagtgaacaaaagggaccgcttggcaaa
cgtattgaatggaactttgcaaaatttcttatcgaccaaaatggcaatgtcatcaaacgt
ttttcatcaaaaacagaacctgaaacaattgttacagaaattgaaagccttatcaatgac
aaatag

DBGET integrated database retrieval system