KEGG   Streptococcus gallolyticus UCN34: GALLO_1596Help
Entry
GALLO_1596        CDS       T01171                                 

Definition
beta-hexosamidase (glycosyl hydrolase, family 3)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GALLO_1596
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    GALLO_1596
Enzymes [BR:sga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GALLO_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1683976..1685616)
Genome map
AA seq 546 aa AA seqDB search
MINLTQNPFYLTEEQSAEVIQLANRLTDEEKVGQLFCLLGSIYSDDELNRLVSDYHVSGF
LFRPMPADDLQKKWARLDQLTQIPLLKAANLEEGGYGANEEGTYFANPLQVAATNDLEIT
RKFAKVCAVEGKAAGCNWNFAPVSDIDFNTQNPITNVRTYGSDVQTVVDNVKCYVQTLQQ
NGMAAACKHFPGDGVDYRDQHLHPTYNSLSAEDWYASYGRVYSEAIDVGLLSVMVGHIVQ
PALEKEINAKLEIADMLPASQSKQLLSGILRGKLGFNGLIITDATIMGGYCMSLPRKAAL
TASINAGCDMFCFSTDFYEDYGYLLEALHDGTLSRERLDEAVIRILALKMTLESMSYPQE
TIESIAWRNECADKSITLVKDIQHLIPFDRERFPQIEITVVGEDEIAEGYKISLLAENYF
KSQGFEVSHYHPLEDDLHGTSQLSKDKLRLILVNCPTASNQTTVRINWSPKHALDMPRFV
DEETYAMISFNNPYHLQDAPRVRTYINAYSPTKASVLASFDKMLGYSPFVGVSPIDAFCG
LVDTHL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttaactcaaaaccccttttatttgaccgaagaacagagtgccgaggttatt
caactggcaaatcgtttaacggatgaagagaaggttggtcaattattttgtttgttaggt
tctatttattcagatgatgagttgaatcgtttggtttctgactatcatgtgagtggtttt
ctctttcgacctatgccagcagacgaccttcagaaaaaatgggctcggctagaccagctc
actcaaattcctcttttaaaagctgcaaatcttgaagaaggcggatacggtgcaaacgaa
gagggtacttattttgccaatcctttacaggttgccgcaactaatgatttagaaatcact
agaaaatttgcaaaagtatgtgctgttgaaggaaaagcagcaggctgtaattggaatttt
gcaccagttagcgatattgatttcaatacccaaaatccgattactaatgttcggacttat
ggttctgatgtgcaaacggtcgttgacaatgtgaaatgctatgtccaaacattgcagcaa
aatggaatggctgcagcttgcaaacattttccaggagacggtgttgattatcgtgaccaa
catttgcaccctacctacaacagtttgtcggcagaagattggtatgctagttacggtcgt
gtttacagcgaagctattgacgtcgggctgttatcagtaatggtaggacatattgttcaa
ccagccttagaaaaagaaattaatgccaaactagaaatcgcagatatgttaccagcaagt
caaagtaagcagctgttatcaggtattctgcgaggaaaacttggttttaatgggcttatc
attacagatgctactattatgggtggctactgtatgtcacttccacgaaaggcagcctta
acggcttctattaatgcaggctgtgatatgttctgtttttcaacggatttttacgaagat
tacggctatttattggaagcattgcatgacggaacactttctcgagaacgcttggatgaa
gcagtcatcagaatcttggctttaaagatgacattagaatcaatgtcctatccacaggaa
actattgagtcgattgcttggcgcaatgagtgtgcggataaatcaattactttggtcaaa
gatattcaacatcttattccgtttgatcgtgaaagatttcctcaaattgaaataaccgtt
gtcggagaagatgagattgctgagggttataaaattagcctactagctgaaaattatttt
aagagccaagggtttgaggttagccattatcatccacttgaagatgacctacatggaact
tcacaattatcaaaggataagttgcgtttgattttggttaactgtcccacagcttccaat
cagacgacggttcggattaattggagcccaaaacacgctcttgatatgcctcgatttgtg
gacgaagaaacttatgctatgatttcgtttaataatccttatcatctccaagatgctcct
cgtgttcgcacatatattaatgcttattcaccaactaaagcaagtgttttagctagtttt
gataaaatgctgggctattcaccatttgtcggtgtaagtcctattgatgctttctgtggt
ttggtggatacacatttgtga

DBGET integrated database retrieval system