KEGG   Streptococcus gallolyticus UCN34: GALLO_1597Help
Entry
GALLO_1597        CDS       T01171                                 

Definition
beta-hexosamidase (glycosyl hydrolase, family 3)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sga00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sga00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1685633..1687309)
Genome map
AA seq 558 aa AA seqDB search
MVDLKAKPFYLDERAVQWVETTLNNMSLDEKLGQVFIQLAQPDKDYLDEKILGKHVGGIL
FRQNEAKVVQETLRYIQKSSKIPVLFCGNLEEGGIGLAKEGTYFSKQMETIATGNTDFAY
QNGRVLAREASALGCHMSFGPVVDMTIDWRSAITSTNTYGADADQVLKYASANMQGQMDN
GLVTAVKHFPGEGADDHDQHYNCEINEMSIAEWDNVFGKVFQGLIDQGTMSIMPGHIALP
SYQKYYADDMSGQVMPATYSKALLTNLLREKLGFNGLIVSDNTCIAGASNYLPRYQAVPQ
MLMAGIDLILYSFDMDEDLDYLKAALQDGRLTMERLNEAVTRNLAVKASLGLHDKQKEGT
LVPDEAALDVLGCVEHRDLARRCASDAVTLVKNGQNLLPLNTKEHQKILLTVISDPWERE
HVETLVKKQLEEAGFTVTVSNPNDSIPKDNSVRNWQKKYDLFLYISHQESARKDKLSLRI
NWHQAGNLPRFSADIPTVHISFGNPFELYDLPNIKTYINAYCLTDIVVEETLKKVLGQSD
FKGISPVDPFCGKDYLRY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatttaaaagcaaaaccattttatctggatgagcgtgctgttcagtgggttgaa
acaacattgaacaatatgtctttagatgaaaaattagggcaagtttttattcagctggca
caacccgataaagattatctggatgagaaaatccttggtaagcatgttggtgggattctt
tttcgccaaaatgaagcaaaagtggtacaagaaaccttgcgctacattcaaaaatcgtca
aaaattcctgtgctattttgcggtaatttagaagaaggtggtatcggtctagctaaggaa
gggacatatttttctaagcaaatggaaaccattgctactggcaatacggactttgcttat
caaaatggtcgtgtattagctagagaagctagtgctttaggatgtcatatgtcatttggt
ccagttgtggatatgactattgactggcgttcagccattacatcaacaaatacttatgga
gccgatgccgaccaagttttgaaatatgcttctgccaatatgcaagggcaaatggataat
ggtctggtaacagcggttaagcattttccaggggaaggtgcagatgaccatgaccaacat
tacaactgtgaaatcaatgagatgtctattgccgaatgggacaatgtttttggtaaggtg
tttcaaggtttgattgaccaaggcacaatgagtatcatgccaggacatatcgctcttcca
agctatcaaaaatattatgctgatgatatgagtgggcaagtgatgccagcgacatattct
aaagcattattgaccaatcttcttagggagaaacttgggtttaatggacttattgtcagt
gataacacttgtattgctggcgcaagcaattatcttccacgctatcaagcggtaccacag
atgttaatggcaggaattgacttaattctgtatagctttgatatggatgaggatttagat
tatctaaaagcagcactccaagatggtcgtttgactatggaacgcttgaacgaagctgtg
actagaaatcttgctgtcaaggcaagtttaggcttgcatgataagcaaaaggaaggaaca
ttagtgccagacgaagccgctttggatgttttgggctgtgtggaacaccgtgatttggca
agacgttgtgcaagtgatgctgtgacattagtgaaaaatgggcaaaatctcctcccccta
aacacaaaagagcatcaaaaaattttgttaaccgttatttcagatccatgggaacgtgaa
catgtcgaaactcttgttaagaagcagctagaagaagcagggtttacagtcacggtttca
aatcctaatgattctattcctaaggataatagtgtacgtaattggcagaaaaaatatgac
ttgttcctttatatttctcatcaggagtcagctcgaaaagataaattatctcttcggatt
aactggcatcaagcaggcaaccttccacgtttttctgcggatattccaaccgtacatatt
agttttggtaatccttttgaattgtatgacctaccaaatataaagacttatatcaatgct
tattgtttaacagacattgttgttgaagaaacattgaaaaaagttttaggtcagagcgat
tttaaagggattagtcctgtcgatcctttctgtggaaaagattatttacgatactaa

DBGET integrated database retrieval system