KEGG   Streptococcus gallolyticus UCN34: GALLO_1843Help
Entry
GALLO_1843        CDS       T01171                                 

Definition
desuccinylase, deacetylase or peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sga01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sga00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1916335..1917717)
Genome map
AA seq 460 aa AA seqDB search
MVVSDNNQLQKFENDDVAQYYFEILRQLIAKKSIFAQQIGLAEVANYLGDIFTEAGAEVT
IDDTCTAPFVLARFKSNRPDAQTIIFYNHYDTVPADDDQPWSSNPFELTIRDGYMYGRGV
DDDKGHITARLTAVQKYRREFGDFPVNIIFIMEGSEESASVGLETYLDKYANELRGADLL
VWEQGISNAKGQIEISGGTKGIVTFDMIVDSAKVDIHSKFGAVIESASWYLLNAIASLRD
ETGRILVDGIYDQVIEPSERELSLILEHANLDADNLKTLYGLNLPMLTRDKEKLVRTLFF
EPAITIEGISTGYQGQGVKTILPAKAQAKMEVRLVPGLEPKDVLQKIEQHLQQHGFEQVE
LVYTLGEKAYRSDMSAPAILNVIEIAKVFSPNGVSVLPTTAGTGPMHQFFEALEVPIASF
GIGNPDSRDHAGDENVNLADYYTHIEMIEELIKSYDKTDY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtagtaagtgataataatcagttgcagaagtttgaaaatgatgacgttgctcaatat
tattttgagattttacgtcagttaattgctaaaaaatcgatttttgcacagcagattggg
ttagcagaagtagcaaattatctaggcgatatttttactgaagctggtgctgaagtgacg
attgatgatacttgtacggcgccgtttgttttggcacgttttaagagcaatagacctgat
gctcagacgattattttttacaaccattatgatactgtgccagctgatgatgaccagcct
tggtcgtcaaatccttttgaattaaccatccgtgatggctacatgtatggacgtggtgtt
gatgacgataaagggcatatcacagcacgcttgacagccgttcagaagtatcgccgtgag
tttggagattttccagttaacattatatttattatggaaggttcggaagaatcagcttct
gtgggtcttgaaacctatcttgacaaatacgctaatgagctccgtggcgcggatttattg
gtgtgggagcaaggtatttcaaatgccaaaggtcagattgaaatttctggtggaacaaaa
ggtattgtcacctttgatatgattgttgattctgctaaggttgatattcattcgaaattt
ggtgcggtcattgagtcagcatcatggtatttgcttaatgcgattgctagccttcgtgat
gaaactggtcgcattttggttgacgggatttatgaccaagtcattgagccaagtgagcgt
gagttgtcacttatcctagaacatgccaatcttgatgccgataacctaaaaacactatat
ggtttgaatttgccaatgttgacaagggataaggaaaagttagttcgaacgcttttcttt
gaaccagctatcacgattgagggaatttcaacaggatatcaaggtcaaggtgtcaaaacg
attctaccagctaaagctcaggctaaaatggaagttcgtttggttcctgggcttgaacca
aaagatgttcttcagaaaattgaacaacatttgcaacaacatggctttgaacaggtggag
ttggtttacacattgggcgaaaaggcatatcgtagtgatatgtctgccccggctattctc
aatgtgattgagattgcaaaggtattttcaccaaatggtgtttcagttttgccgacgact
gctggtactggaccaatgcaccaattctttgaagcattagaagttccgattgcttctttt
ggtattggcaatccagacagccgtgaccatgctggagatgaaaatgttaatttggcggat
tattacacccacattgaaatgattgaggagttgattaagagttatgacaaaaccgattat
taa

DBGET integrated database retrieval system