KEGG   Streptococcus gallolyticus UCN34: GALLO_1932Help
Entry
GALLO_1932        CDS       T01171                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    GALLO_1932
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GALLO_1932
  Lipid metabolism
   00071 Fatty acid degradation
    GALLO_1932
  Amino acid metabolism
   00350 Tyrosine metabolism
    GALLO_1932
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GALLO_1932
   00626 Naphthalene degradation
    GALLO_1932
Enzymes [BR:sga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GALLO_1932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2006458..2007501)
Genome map
AA seq 347 aa AA seqDB search
MKSAIFEKAGLMTVEEVAKPTLQADDDVIIKVVRACVCGSDLWSYANGDEKAAHSENSGH
EALGIVEEVGSAITTVQPGDFVIVPFTHGCGECDACRAGFDGTCDNHPGYTNWSSGFQSE
YVRFHYANWALIKIPGQPSDYSEGMMKSLLTLADVMPTGYHAARVADVKRGDKVVVIGDG
AVGQCAVIAAKMRGASQIVLMSRHEDRQQMALASGATAVVAERGEEGIAKVRQILGGGAD
AALECVGTEAAIEQALGVIHNGGRVGFVGVPHYNNRPLGSTFAQNITVGGGSASVTTYDK
QLLLKAVLDGDINPGRVFTNTYRLDDINQAYKDMQDRKAIKSMIVMD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgctatttttgaaaaagctggtctgatgactgttgaagaagtggctaagcca
actttgcaagctgacgatgatgttattatcaaggttgttcgtgcttgtgtctgcggttct
gacctttggtcttatgctaatggtgatgaaaaagctgcacattctgaaaactcaggtcat
gaagctctcggtattgttgaagaagttggttctgccattacgaccgtacaacctggtgat
tttgtcatcgtgccatttactcacggttgtggggaatgtgatgcttgccgtgctggtttt
gacggaacgtgtgataaccaccctggctatacaaactggtcttctggtttccaatcagaa
tatgtccgcttccactatgctaactgggctttgattaaaatccctgggcaaccgtctgat
tattcagaaggtatgatgaaatcactccttactttggctgatgttatgccaacaggttac
catgctgcgcgtgttgccgacgtaaaacgtggcgataaagtcgttgttattggtgatgga
gcggttggacaatgtgccgttattgcggcgaaaatgcgcggagcttctcagattgtcttg
atgagccgacacgaagaccgtcaacaaatggcgcttgcttcaggagctaccgctgtcgtt
gctgaacgcggtgaagaaggcattgctaaggttcgtcaaattcttggcggaggagctgac
gctgctcttgaatgtgtcggtacagaagccgctatcgagcaagctctcggtgttatccac
aatggcggacgtgttggatttgttggtgtccctcattacaataatcgtccgctaggttca
acatttgcacaaaacattactgtcggaggcggttcagcttctgtcactacctacgacaaa
caactccttcttaaagcagtccttgacggtgacatcaacccaggtcgcgtctttacaaac
acttatcgcttggatgacatcaaccaagcctacaaagacatgcaagaccgcaaagcaatc
aaatcaatgattgtcatggactaa

DBGET integrated database retrieval system