KEGG   Streptococcus gallolyticus UCN34: GALLO_1950Help
Entry
GALLO_1950        CDS       T01171                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GALLO_1950
Enzymes [BR:sga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GALLO_1950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2023498..2025978
Genome map
AA seq 826 aa AA seqDB search
MEYFFSGTIDRIIFENASNFFKILLLEIEDTDSDFDDFEIIVTGTIADIIEGENYTFWGE
LTQHPKYGEQLRVTRYERSKPTSSGLIKYFSSDHFKGIGKKTAEKIVQLYGDNTIDKILE
DPSKLDSISGLSKENKDNFLTKLKLNYGTELILSKLAEYGLTNRVAFEIFNQYKEDSLDI
IQENPYQLVEDIQGIGFKIADQLAEQLGIEADAPQRFRAALVHSLFETSIERGDTYVEAR
DLLENAITTLEEARQIELDPAAVAKELSTLIAEDKVQNVGTKIFDNTLFYAESGIKKHLT
RILDTPLDQNFSDGDLQEEIADVEEAFGISYDDVQKNAIKEALKSKVFILTGGPGTGKTT
VINGLIAAYADLHHIDLEKKDIPIILAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAIDDYLDCDLIIIDEFSMVDTWLANQLFSSISSNTQVIIVGDSDQLPSVGPGQVLADLL
KIEALPQLALTKIFRQSEDSTIVTLANQMRLGKLPADFTQKKADRSYFEASAQYIPEMIP
KIVSAAVKSGIDPQEIQILAPMYRGAAGINRLNTIIQDLLNPLKDQLSFAFGEMNFRKGD
KVLHLINDAELNIFNGDIGYITDLIPAKYTESKQDELYMSFDGTEVIYPRNEWHKITLAY
AMSIHKSQGSEFQVVILPITRQSHRLLQRNLIYTAITRSKSKLVMLGEIAAFDYAIKNEG
AKRNTYLVQRFTSSAQEEESIDLQTEISQQTSPKTDNEAEKITSPTSPQTNISKEENIQL
TLDIAENEQTQTEQEPKIYRLTEENLAFINPMIGITQADIEQFFKK
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttcttttctggcacaattgaccgtattatttttgaaaatgccagtaatttc
tttaaaattttattactcgaaattgaggatactgattcagactttgatgattttgaaatc
attgttactggaacaattgctgatattatcgagggagaaaattatacgttttggggtgaa
ttaacgcaacacccaaaatatggcgaacagctcagagtcacacgttacgagcgcagcaaa
ccaacttcttccggtcttattaaatatttttcaagcgaccatttcaaaggaattggtaaa
aaaactgctgaaaaaattgtgcagctttacggcgacaataccattgataaaatcctagaa
gaccctagtaaattagacagtatttctgggctctctaaggaaaataaagacaacttttta
accaaactcaagcttaattatggtacagagctcattttatccaagttagcagagtatggc
ttgactaaccgcgttgcctttgaaatttttaatcaatacaaggaagacagtcttgatatt
atccaagaaaatccttatcaattggtcgaagacattcaagggattggttttaaaatcgct
gaccaactcgctgaacaattgggaatcgaagcggacgctcctcaacgttttcgtgctgct
ctcgtgcacagtctttttgaaacttctattgaacgaggagatacttacgtcgaagcgcgt
gatttgcttgaaaatgccattaccacccttgaagaagctagacaaattgagttagacccc
gcagccgttgccaaagaattatcaacgcttatcgctgaagataaggtgcaaaatgtcggt
accaaaatttttgacaatactcttttctatgctgaatcaggtatcaaaaaacacctgaca
cgtatccttgatacgccactcgaccaaaacttttcagatggtgacttgcaagaagaaatt
gctgacgttgaggaagctttcggcatttcttacgatgatgtgcaaaaaaatgctatcaaa
gaagcgctcaagagcaaggtgtttattttgactggtggtcctgggacgggaaaaacgact
gttatcaacggtttgattgctgcctacgcagaccttcatcacattgaccttgagaagaaa
gatattcctatcatcttagcagcgccaacaggacgtgctgcccgccgtatgaatgaatta
acaggcttgccaagtgcgactattcaccgccatttggggttaaatggtgataacgactac
caagctattgatgactatctcgactgtgacttgattatcattgatgaattttcaatggtt
gatacttggcttgccaatcaactctttagttccatttcgtccaatactcaagtcatcatc
gttggagatagtgaccaattgccgtctgtcggtcctgggcaagtattagctgatttatta
aaaattgaagctcttcctcaactagcattgactaaaatctttagacaatcggaagattca
accattgttacacttgctaatcagatgagacttggaaaattaccagctgacttcacacaa
aagaaagctgaccgttcttattttgaagcaagtgcacaatatatcccagaaatgattcct
aaaattgtcagcgcagctgttaagagtggcattgacccacaagaaatacaaatccttgcc
ccaatgtaccgtggcgcagctgggattaatcgacttaataccattattcaggatttactt
aacccacttaaagatcaactctcgtttgcctttggtgagatgaatttccgtaagggtgac
aaagttctccacctcatcaacgatgctgaactcaatattttcaatggtgatatcggctat
attacagaccttattcctgctaaatataccgaatccaaacaagacgaactttacatgtct
tttgacggcaccgaagttatctaccctcgtaatgaatggcataaaatcacccttgcttac
gccatgtcaatccacaaatcacaaggtagcgaatttcaggttgtcattttgccgatcact
cgccaaagtcaccgactcttacaacgtaacctcatttacacagctatcacccgctctaag
agtaaattagtgatgttaggggaaattgccgcctttgattacgccataaaaaacgaaggc
gctaagcgcaacacctatcttgttcaacgctttacaagctccgcacaagaagaagaaagt
attgatttacaaactgaaatttctcaacaaacatcacctaaaacagataatgaagctgag
aaaatcacctctccaacttctccccaaacaaatatttctaaagaagaaaacattcaactg
acactagatattgccgaaaatgagcaaacacaaacagagcaagaaccaaaaatctatcgc
ttgacagaagaaaacttggcatttatcaacccaatgattggcattacccaagccgacatt
gaacaattttttaagaaataa

DBGET integrated database retrieval system