KEGG   Streptococcus gallolyticus UCN34: GALLO_2093Help
Entry
GALLO_2093        CDS       T01171                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GALLO_2093 (galU)
   00052 Galactose metabolism
    GALLO_2093 (galU)
   00500 Starch and sucrose metabolism
    GALLO_2093 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    GALLO_2093 (galU)
Enzymes [BR:sga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GALLO_2093 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2172909..2173823
Genome map
AA seq 304 aa AA seqDB search
MRKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKS
KRSIEDHFDSNFELEYNLEHKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKAFV
GNEPFVVMLGDDLMDINNDKAVPLTKQLINDYETTHASTIAVMPVPHEEVSSYGVIAPQG
EGIDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFNILETQEPGAGNEIQLTDAIDT
LNKTQRVFARQFNGDRYDVGDKFGFMKTSIDYALQHPQIKDSMKQYLIDLGKELEADSKK
EETK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagttagaaaagccgtcattcccgctgctggtcttggaacacgcttcttgcca
gcaactaaagcactcgctaaagagatgcttccaattgttgataaaccaaccattcaattt
atcgtcgaagaagccttgaaatcaggtatcgaagacattttggttgttactgggaaatca
aaacgttcaatcgaagaccacttcgattcaaattttgaattagaatacaatttggaacat
aaagggaaaactgaccttctcaaacttgtgaatgatacaacagctatcaatcttcacttt
atccgtcaaagccatccacgcggattgggagacgctgttctgcaagccaaagcctttgtt
ggtaacgaacctttcgttgttatgcttggtgatgaccttatggatatcaataacgataaa
gctgtaccattgacaaaacaactgatcaatgactacgaaaccacacacgcatcaactatc
gccgttatgcccgtaccacacgaagaagtatcatcttacggtgttattgctcctcaaggc
gaaggcattgacggactttatagcgttgaaacatttgttgaaaaaccagcccctgaagat
gcaccaagtgaccttgcaatcatcggtcgttatcttcttactccagaaatcttcaatatc
cttgaaacacaagaacctggagctggtaatgaaattcaattgacagacgctatcgatacc
cttaacaaaacacaacgtgtttttgcgcgccaatttaacggtgaccgctatgatgtcggt
gacaaatttggttttatgaaaacttctattgactatgcccttcaacaccctcaaatcaaa
gatagcatgaaacaatatcttatcgatttaggtaaagaattagaagctgattcaaaaaaa
gaagaaactaaataa

DBGET integrated database retrieval system