KEGG   Streptococcus gallolyticus UCN34: GALLO_2111Help
Entry
GALLO_2111        CDS       T01171                                 

Gene name
tkt
Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GALLO_2111 (tkt)
   01230 Biosynthesis of amino acids
    GALLO_2111 (tkt)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GALLO_2111 (tkt)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    GALLO_2111 (tkt)
Enzymes [BR:sga01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     GALLO_2111 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2191146..2193116)
Genome map
AA seq 656 aa AA seqDB search
MSQLSVNAIRFLGIDAIEKAKSGHPGVVMGAAPMAYSLYTKHLHVNPAVPNWINRDRFIL
SAGHGSMLLYALLHLSGFDVTIDDLKHFRQWGSKTPGHPEYGHTDGVDATSGPLGQGISM
AVGLAQAERFLAAKYNKPDFPIFNHYTYVIAGDGDFMEGVSGEASSYAAKQQLNKLIVLY
DSNDICLDGETNAAFTENVRARYNAYGWHTAIVEDGTDINAISLAIEEAKASNKPSLIEI
KTTIGYGAPTKGGTNAVHGAPLGAEETAATRRHLGWEYPPFDVPEEVYDDFKENVEKRGV
AAYQKWLEMLADYKTAYPNEAKEVEAIIRGENPATLTEADFPVFDDGFSQATRHSSQAAI
NAAARVLPNFLGGSADLAHSNMTYINDDGLQDAEHPLNRNIQFGVREFGMATILNGMALH
GGLRVFGGTFFVFSDYLKAAMRLSALQGLPVVYVFTHDSIAVGEDGPTHEPIEQLSGLRA
IPNLTVLRPADARETQAAWHYALTQKSTPTALILTRQNLVVEKGTSFTAVEKGAYVVYES
SADFDTILLASGSEINLAVEAAKKLVAQGGKVRVVSVPSTELFDAQPAEYKEMILPNAVR
KRVAIEMAATQPWYKYVGLDGKAIGIDTFGASAPASEVIEHYGFTVDNIVNTVNHL
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaattatctgttaatgctattcgttttttaggaattgatgccattgaaaaagcc
aaatcaggtcatccaggagtcgttatgggagctgctccaatggcgtacagtctttacact
aaacatttacatgtcaatccagctgttccaaactggattaatcgcgaccgcttcatttta
tcagcagggcatggttcaatgttgctttatgctcttcttcatttgtcaggatttgacgtt
acaattgatgatttgaaacattttcgtcaatgggggtcaaaaacgccaggtcatcccgaa
tacggtcatactgatggtgtggatgcaacctctggaccactaggtcaagggatttctatg
gctgtcggactagcacaggcggaacgtttcttagctgcaaaatacaataaaccagatttt
ccaattttcaatcactatacctatgttatcgctggtgacggtgactttatggaaggagtg
tctggcgaagcatcatcttacgcagctaaacagcaattgaataagttgattgttctttat
gattcaaatgatatttgcctagatggtgagacaaatgctgcttttactgaaaatgttcgt
gcacgctacaatgcttatggttggcatactgctattgttgaagacggcacagatatcaat
gccattagtcttgctatcgaagaagcaaaagcttctaacaagccaagcttgattgaaatt
aaaacaacgattggctacggtgcaccaacaaaaggtggaaccaatgcagttcacggagct
ccactcggtgctgaagaaacagctgccacacgacgtcatcttggctgggagtatccaccg
tttgacgttcccgaagaggtttatgatgattttaaagaaaatgtagagaagcgtggggtt
gcagcatatcaaaaatggttagaaatgctcgcagactacaaaacagcctatccaaatgaa
gctaaagaagttgaagctattattagaggagagaacccagcaacgctcacagaagcagat
tttcctgtttttgacgatggcttttcacaagcaacacgtcactcgtcacaagctgcgatt
aatgcggcagcaagggttcttcctaattttcttggtggctcagctgaccttgctcattca
aacatgacttatattaacgatgatggcttacaagatgctgaacatccacttaatcgcaat
attcagtttggtgttcgtgagtttggtatggcaactattttgaatggtatggcactacat
ggtgggcttcgcgtttttggtgggacattctttgtcttttctgattatcttaaagctgcc
atgcgtctgtctgctctccaaggcttgccagttgtctatgttttcactcatgattccatt
gctgttggtgaggacggaccaactcatgagccaattgaacaattatcaggcttgcgagca
attccaaatttgacagtgcttcgcccagcagatgcccgtgaaacgcaggctgcttggcac
tatgctttgacacaaaaatcaacgccgacagcgcttattttaacacgtcaaaatttagtt
gttgaaaaaggaacaagtttcacagccgtcgaaaaaggtgcttatgttgtttacgagtca
agcgcagattttgataccattcttttagcatcaggatcagaaattaatttagcggtagaa
gcggctaaaaaattagttgcccaaggtggtaaggttcgagttgtttcagtaccgtcaaca
gaattatttgatgcccaaccagcagaatataaagaaatgattctaccaaatgctgttcgt
aaacgtgttgctattgaaatggcggcaacccaaccatggtataaatacgttggtttagac
ggcaaagccatcggtattgatacgtttggagcttcagcaccagcatcagaagtgattgaa
cactacggtttcacagttgataatattgtcaacactgtcaatcatctttaa

DBGET integrated database retrieval system