KEGG   Streptococcus gallolyticus UCN34: GALLO_2197Help
Entry
GALLO_2197        CDS       T01171                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GALLO_2197 (ruvA)
Enzymes [BR:sga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GALLO_2197 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2281770..2282363)
Genome map
AA seq 197 aa AA seqDB search
MYDYIKGKLTKITAKYIVVEAGGLGYIVNVANPYSFSDLVNQEVQIYLHQVIREDAQLLF
GFHTEDEKAVFLNLISVSGIGPTTALAIIAVDDNEGLVNAIDTSDIKYLMKFPKIGKKTA
QQMVLDLAGKFVDVSVENGKASQTKTATNEQLEEAMEALLALGYKAAELKKIRKFFEGTN
ETAEQYIKSSLKMLMKA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatatcaaaggaaaattaactaaaattaccgccaaatacattgttgtcgag
gctggagggctgggctatattgtcaacgttgctaacccatacagtttttcagaccttgtc
aaccaagaggttcagatttatttacaccaagtcattcgtgaagatgcgcaattgttattt
ggttttcacacagaagatgaaaaagctgtttttcttaatttgatttcagtttctgggatt
ggtccgacaactgcgctagcgattattgcggttgatgataatgaagggcttgtcaatgcg
attgacactagtgatatcaagtatttgatgaaatttccaaaaattggaaaaaagacagct
caacaaatggtcttggatttagcaggaaaatttgtcgatgtttcggtggaaaatggcaaa
gcttctcagacaaaaacagctacaaacgagcagcttgaggaagctatggaagctcttttg
gcacttggctataaagctgcagagctcaagaaaattcgtaagttctttgaaggaacaaat
gaaacagcagaacaatacatcaaatcaagccttaaaatgttgatgaaagcttaa

DBGET integrated database retrieval system