KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0053Help
Entry
A964_0053         CDS       T02248                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    A964_0053 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A964_0053 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    A964_0053 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    A964_0053 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A964_0053 (adhP)
   00626 Naphthalene degradation
    A964_0053 (adhP)
Enzymes [BR:sgc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A964_0053 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
71778..72794
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQASTGVEVVEHDLPKVGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLRVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIAVYGAGGLGNLAVQ
YAKKVFNAHVVAVDINADKLQLAKEVGADLTVNGKEIKDVAAYIQEKTGGCHGVVVTAVS
KIAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIRVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVDTAPQVFDEMERGLIQGRKVLDFTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggttgttgttaatcaagctagtacaggtgttgaagttgttgagcatgatctt
ccaaaagttggtcatggtgaagcacttgtaaaagtagaatactgtggtgtgtgccatact
gatttacacgttgcacatggagatttcggccaggtaccaggacgcattttgggtcacgaa
ggcattggtatagtagaagaaattggagaaggcgtaacgtctttgagggttggtgatcgt
gtctctattgcatggttctttgaaggatgcggtcattgcgaatactgtactacaggacgt
gagacgctttgtcgtagtgttaaaaatgctggatacagtgttgatggtggtatgagtgaa
tacgctattgttaccgcggactatgcggttaaggttcctgagggattagatccagctcaa
gcatcatcaatcacttgtgctggagtaacaacatacaaggctatcaaagaagctggagct
gctcctggtcagtggattgcagtgtatggtgcaggtggtcttggaaacttagcagtccag
tatgcaaaaaaagtattcaatgctcatgttgtagctgttgatattaacgcagataaactt
caattagctaaagaggttggagcagatttgacagttaatggcaaagaaataaaagatgtt
gcggcctatattcaagaaaagacaggcggttgtcatggagtggttgtgactgctgtttct
aaaattgcgtttaatcaggcgattgacagcgttcgtgctggaggtacagtggtagctgtt
ggtcttccatcagaatatatggaattgagtattgtaaaaacagtacttgatgggattcgt
gtggttggttccttagttggaactcgtaaagatttagaagaagccttcgcatttggagca
gaaggcttggtagtaccggtggttgaaaaagtgcctgtggatacagctcctcaagtattc
gatgaaatggaaagaggattgattcaagggcgtaaagttcttgactttacaaagtga

DBGET integrated database retrieval system