KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0054Help
Entry
A964_0054         CDS       T02248                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A964_0054 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A964_0054 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A964_0054 (thrC)
Enzymes [BR:sgc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A964_0054 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
72914..74404
Genome map
AA seq 496 aa AA seqDB search
MAIVYQSTRDASNKVTASQAILKGLADDGGLFTPITFPKVDLDFTKLKDASYQEVAKLVL
SAFFDDFTEQELDYCISQAYDTKFDTTEIAPLVKVGDRYHLELFHGPTIAFKDMALSILP
YLLTTAAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKNGVSYIQELQMI
TQAGQNTHVVAIEGNFDDAQTSVKEMFNNSILRSKLSQQHMQLSSANSMNIGRLVPQIVY
YIYAYAQLVKSKEISIGQPINFSVPTGNFGNILAAYYASQIGLPVTKLICASNDNNVLTD
FFKTQTYDKNREFKVTSSPSMDILVSSNLERLIFHLLGDDAETTKKLMEDLVTTGEYALE
ARQANILESFVAGFATEQFVELDIKRLFDQYQYIEDPHTAVASAVYQAYQTETKDQTPTV
IVSTASPYKFPCVVTKAITNKEEIQDFAAISILNDLSGVSLPRAVTDLQKAEVIHRTVVP
TSNMRETLEECLGLKQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtatatcaatcaacacgtgatgctagtaataaagtgacagctagtcaagcg
attctaaagggattagctgacgatggaggactctttacccccatcacatttccaaaagtt
gatttagatttcactaaacttaaggatgcttcctaccaagaagtggctaaactcgttttg
tcagctttttttgatgattttactgaacaagaattggattactgtattagtcaagcttat
gatactaaatttgatacaactgaaatagccccgttagtaaaggttggagaccggtatcac
cttgaattatttcacggtcctacaattgcatttaaagatatggctttatccattcttcct
tatttgctaacaacagcagccaaaaaacaaggggtcgataataaaatcgttattttaaca
gcaacatcaggtgacactggcaaggcagcgatggcaggttttgcagatgttccaggaact
gagattattgtcttttatcctaaaaatggtgttagttatatccaagaattgcagatgata
acacaagccgggcaaaatacccatgttgttgcgattgaaggaaattttgatgatgcacag
acttcggttaaagaaatgttcaataattccattcttcgatcaaaattatcacagcagcat
atgcagttatcatcagccaattcaatgaacatcggtcgccttgttcctcaaattgtttac
tatatatatgcatatgctcaattagttaagtcaaaggaaatctcaattggtcaaccaatt
aattttagtgtacctacaggaaattttggtaatattttagcagcatattatgctagtcaa
attggattacctgttaccaaactcatttgtgcctcaaatgataataacgttctaacagat
ttttttaagacacaaacctacgataaaaatcgagaatttaaagtgacatcaagtccctct
atggatattttggtctcctctaatctagaacgattaatctttcaccttttaggcgatgat
gcagaaacgactaaaaaattaatggaagatttagtgactactggggagtatgccttagag
gctaggcaagcaaatattttagagagctttgtagcgggatttgcgacagaacaatttgtt
gaattagacatcaaacgtttatttgaccagtatcagtatatagaggatccgcatacagct
gtagcatcagctgtttaccaagcttatcagacagaaactaaagatcaaactccaacagta
attgtgtcaacagcaagtccttataagttcccgtgtgttgttacaaaggctattacaaat
aaagaagagatacaggatttcgctgctatttcaatcttaaacgatttgtcaggtgtttct
ttacctagggcggttacagatctacaaaaggccgaagtaatccatagaacggtagtacct
acctcaaatatgcgagaaacgcttgaagagtgtctaggtttgaaacaataa

DBGET integrated database retrieval system