KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0117Help
Entry
A964_0117         CDS       T02248                                 

Gene name
gltX1
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    A964_0117 (gltX1)
Enzymes [BR:sgc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     A964_0117 (gltX1)
Amino acid related enzymes [BR:sgc01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   A964_0117 (gltX1)
Transfer RNA biogenesis [BR:sgc03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    A964_0117 (gltX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
127759..129213
Genome map
AA seq 484 aa AA seqDB search
MANKIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGDFVIRIEDTDRKRHVEDGERSQL
ENLRWLGMDWDESPETHENYRQSERLELYQRYIDQLLAEGKAYKSYVTEEELAAERERQE
LAGETPRYINEFIGMSETEKEAYIAEREAAGIIPTVRLAVSESGIYKWTDMVKGDIEFEG
SNIGGDWVIQKKDGYPTYNFAVVIDDHAMQISHVIRGDDHIANTPKQLMVYEALGWEAPQ
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMSEAVFNFIALLGWNPGGEEEIFSR
EQLINLFDENRLSKSPAAFDQKKMDWMSNDYLKNADFESVFALCKPFLEEAGRLTDKAEK
LVELYKPQLKSADEIVPLTDLFFADFPELTEAEKEVMAAETVPTVLSVFKEKLVSLSDEE
FTRDTIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIYLLGKEKSVQHIDNM
LAKL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
ttggctaataagattcgtgtgcgttatgcaccaagtccaacaggattgttacacatcgga
aatgcgcgtactgcgctctttaactacctttatgctcgccatcatggtggagattttgtt
attcgtattgaagatactgaccgaaaacgccacgtcgaagatggtgaacgctctcaattg
gagaacttacgttggctaggtatggactgggatgaaagtcctgaaacacatgaaaattat
cgtcaatcagaacgccttgagctctaccaacgttatattgatcagttgttagcagaaggt
aaagcctacaagtcctatgtgactgaggaagaattagcagcagagcgtgaacgccaagaa
ttggcaggcgaaacacctcgctatatcaacgaatttatcggaatgtcagaaactgaaaaa
gaagcttacattgcagagcgtgaagcagcaggcatcattccgacagtacgccttgctgtt
agtgaatctgggatttataaatggactgatatggtaaaaggtgacattgagtttgaaggc
tctaatatcggcggagactgggttattcagaagaaagatggttatccaacttacaatttc
gcagtagtcattgatgatcatgccatgcaaatttcgcatgttatccgtggcgatgaccat
attgcaaatacgccaaaacaattaatggtttatgaagcactcggttgggaagcgccacaa
tttggtcacatgacattgattataaactcagagactggtaagaagttatcaaaacgcgac
accaatactcttcaatttatcgaagactatcgtaaaaaaggttatatgtcggaagctgtc
tttaatttcattgcccttcttggctggaatcctggtggagaagaagaaatcttctcacgc
gagcaattaattaatctatttgatgaaaatcgtcttagcaaatcaccagcagcattcgat
cagaagaaaatggattggatgagtaatgattacctaaaaaatgctgattttgagagtgtt
tttgcactttgcaaaccattcttagaagaagctggtcgacttacagacaaagctgaaaaa
ttagttgagctttataaacctcaattaaaatcggctgatgagattgtaccattaacagac
cttttctttgcagattttccagaattaacagaagccgaaaaagaagtaatggcagcagaa
acagtcccaacagtcttatctgtttttaaggaaaagttagtatcgctttctgacgaagaa
ttcactagagatactattttccctcaaattaaggctgttcaaaaagaaacaggtattaaa
ggtaagaacctatttatgcctattcgtattgcggtttctggtgaaatgcatggaccagag
ttaccagatactatttatttattaggtaaagaaaaatcagttcaacatatcgataatatg
ttagcaaaattataa

DBGET integrated database retrieval system