KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0281Help
Entry
A964_0281         CDS       T02248                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    A964_0281 (glpK)
Enzymes [BR:sgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     A964_0281 (glpK)
Exosome [BR:sgc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A964_0281 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
290753..292261
Genome map
AA seq 502 aa AA seqDB search
MSSEEKYIMAIDQGTTSSRAIIFNKKGEKIASSQKEFPQIFPQAGWVEHNANQIWNSVQS
VIAGAFIESSIKPGQIEAIGITNQRETTVVWDKKTGLPIYNAIVWQSRQTAPIADQLKQE
GHTNMIHEKTGLVIDAYFSATKVRWILDHVPGAQERAEKGELLFGTIDTWLVWKLTDGLV
HVTDYSNAARTMLYNIKELKWDDEILELLNIPKAMLPEVKSNSEVYGKTTPFHFYGGEVP
ISGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEMQLSQNNLLTTIGYGINGKV
HYALEGSIFIAGSAIQWLRDGLRMIETSSESEGLAQSSTSDDEVYVVPAFTGLGAPYWDS
NARGSVFGLTRGTSKEDFVKATLQSIAYQVRDVIDTMQVDSGIDIQQLRVDGGAAMNNLL
MQFQADILGIDIARAKNLETTALGAAFLAGLSVGYWESMDELKELNATGQLFQATMNESR
KEKLYKGWRKAVKATQVFAQED
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagaagaaaaatacattatggcgattgaccagggaacaacaagctctcgagca
attatttttaataaaaaaggtgaaaaaattgcgagtagccaaaaagaatttccccaaatt
tttcctcaagcaggctgggtagagcataatgctaatcagatttggaattctgttcaatct
gtcattgctggagcttttattgaatcaagcatcaaacctggacagatagaggctattggg
attaccaatcaacgtgaaacaactgttgtttgggataaaaaaacaggtcttccaatttat
aatgctattgtatggcaatcgcgacaaacagccccgattgctgatcaattgaagcaagaa
ggtcatactaacatgattcatgaaaaaactggtcttgtcattgatgcttacttctcagca
acaaaagttcgttggattttagaccacgttcctggagcacaggaacgtgctgaaaaagga
gagttgctttttggaacaattgatacttggttagtttggaagttaactgatggtctcgtc
catgttacagactattcaaatgctgctcgtacgatgctttataatattaaagaacttaaa
tgggatgatgaaattttagagttactaaatattcctaaagcaatgttaccagaagtaaaa
tctaattctgaagtttatgggaaaactactccattccatttttacggtggagaggtgcca
atttctggtatggctggtgaccaacaggcagcattatttggacagttggcctttgaacct
ggtatggtaaaaaacacttatggtacaggttccttcattatcatgaatacgggcgaagag
atgcaactgtctcaaaataatctattaacaacgattggttacggcattaatggtaaggtt
cattatgcacttgaaggatcaatcttcattgcaggaagcgctattcaatggttacgtgat
ggtcttagaatgattgaaacgtcaagtgagtcagaaggccttgctcaatcatcaacaagt
gacgatgaggtttatgtggttccagcttttacaggtttgggtgcaccgtattgggattca
aatgctagagggtcagtatttggattaactcgtgggacaagtaaagaagattttgttaaa
gctacacttcagtcaattgcttatcaagtacgagacgttattgacactatgcaagttgat
tcaggaattgatatccaacaacttcgtgtagatggtggagctgcaatgaataatttatta
atgcaattccaagcggatattttagggattgatattgctcgtgcgaagaaccttgaaact
actgccttgggtgcagctttcttagccggactttcagttggctattgggaaagtatggat
gaactaaaagaactgaacgcaacaggacaacttttccaagcaacaatgaatgagtctcga
aaagaaaaactgtataaagggtggagaaaagctgtcaaagcgacacaagtatttgctcaa
gaggattaa

DBGET integrated database retrieval system