KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0412Help
Entry
A964_0412         CDS       T02248                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A964_0412 (galU)
   00052 Galactose metabolism
    A964_0412 (galU)
   00500 Starch and sucrose metabolism
    A964_0412 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    A964_0412 (galU)
Enzymes [BR:sgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A964_0412 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(425885..426784)
Genome map
AA seq 299 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGKSK
RSIEDHFDSNFELEYNLKEKGKNELLKLVDETTSIRLHFIRQSHPRGLGDAVLQAKAFVG
NEPFVVMLGDDLMDITNNKVIPLTKQLINDFEATHASTIAVMEVPHEDVSAYGVIAPQGE
GVNGLYSVNTFVEKPSPEEAPSNLAIIGRYLLTPEIFNILETQKPGAGNEIQLTDAIDTL
NKTQRVFARKFTGDRYDVGDKFGFMKTSIDYALQHPQVKDDLKKYIIDLGKSLEKTSKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcagaaaagcagttatccctgccgctggtttaggaacacgttttttacctgct
actaaagctttagctaaagaaatgcttccaatcgttgataaaccaactattcaatttatt
gttgaagaagcactaaaatctggaattgaagatattttagttgtaactggtaaatcaaaa
cgttctatagaagaccactttgattcaaattttgaattagaatataacctaaaagagaaa
gggaaaaacgaacttctcaaacttgttgatgaaacaactagcattcgactccattttatt
cgacaaagtcatcctcgtgggcttggagatgctgtgctacaagcaaaagccttcgttggt
aatgaaccttttgttgttatgctaggtgatgatctaatggatattaccaataataaagtt
attcctctcaccaaacaattaattaatgactttgaagctactcatgcatcaacaattgct
gttatggaagttccacatgaagatgtttctgcttacggtgttatcgctccacaaggagaa
ggagttaatggtctatatagcgttaacactttcgttgaaaaaccttctcccgaagaggct
ccaagtaatttggcaatcattggtcgctacttgttaactccagaaatttttaatatttta
gaaactcaaaaacctggtgcaggaaatgaaattcaactaaccgatgctatcgatacttta
aataaaacgcaacgtgtttttgctagaaaatttacaggagaccgttatgacgttggtgat
aagtttggttttatgaaaacatctattgattatgctcttcaacacccacaagttaaagat
gacttgaagaaatatatcattgatttaggaaaatctctagaaaaaacatctaagaagtaa

DBGET integrated database retrieval system