KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0467Help
Entry
A964_0467         CDS       T02248                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A964_0467
   00052 Galactose metabolism
    A964_0467
Enzymes [BR:sgc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A964_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483734..484735
Genome map
AA seq 333 aa AA seqDB search
MTIIKKNFGEKLAFLYELKNKNGMKVTLTNFGARIVDIFIPIDEHLRNISLSATSVEDYY
QKDIYVGATVAPVAGRISGAKTHIKGKCYHFTENEPNRTLHSGVDTSVEQYWSTEIEDKE
NKIIFSLFLPDGKNGFPGNVTVIATYQLTEENELKVNYQAQSDCDTIFNPTNHVYFNLTG
DFQKSVASHQLKISSQEFVPLGKDHLPTGEILTVEGTDFDFREFALFSKGLNRFSFQTRL
VNGFDHPWLLEVGNNAVEVVSPDNKISLIMKTNQPAVVIYTYNHGPTALAACHGAFSLEC
QSLPNACNLENLGSILLEKGKVFDSHFSYRFVF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactattattaagaaaaacttcggagagaagctggcattcctctacgaattaaaaaat
aaaaatggaatgaaggtcactttgacgaattttggtgcacgtatagttgatatcttcatt
ccgattgatgaacacttgcgtaatattagtttatcggctacttctgttgaagattattat
caaaaagatatttatgtgggggcaacggtggcccctgtggcaggtagaatttctggagct
aaaacccatatcaaaggaaaatgttatcattttactgaaaatgaacctaataggacatta
catagtggtgttgatacatctgtagaacagtattggtctacagaaatagaagataaagag
aataaaattatcttttctctctttcttccggatggtaaaaatggctttcctgggaatgtg
actgtgatagctacttatcagttgacagaagaaaatgaactcaaggtcaactatcaagca
caatctgattgtgataccatttttaacccaacaaatcatgtatattttaatttaacaggg
gattttcaaaaatccgttgctagccatcagttaaagatttcaagccaagagtttgtgcca
ctagggaaagaccatttacctactggtgaaatactgactgtggaaggtacagactttgat
tttagagaatttgcccttttttcaaaaggtctaaatcgcttttctttccaaacgagatta
gtaaacggatttgatcatccgtggcttttagaagtaggcaataatgccgttgaggtagtt
agtcctgataataaaataagcttaataatgaaaaccaatcaaccagctgttgttatttac
acctataatcatggtccaacagcactagcagcttgtcatggagcttttagtttagaatgc
caatctcttcctaatgcttgtaatctagaaaacttaggatcaattttgctcgaaaaaggg
aaggtatttgatagccacttttcttatcgttttgtgttttaa

DBGET integrated database retrieval system